Identification

Name
Liraglutide
Accession Number
DB06655
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones
Description

Victoza contains liraglutide, an analog of human GLP-1 and acts as a GLP-1 receptor agonist. The peptide precursor of liraglutide, produced by a process that includes expression of recombinant DNA in Saccharomyces cerevisiae, has been engineered to be 97% homologous to native human GLP-1 by substituting arginine for lysine at position 34. Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor.

Protein chemical formula
C172H265N43O51
Protein average weight
3751.2 Da
Sequences
>Liraglutide Sequence (gamma-E-palmitoyl at E21)
HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG
Download FASTA Format
Synonyms
  • Arg34Lys26-(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-1[7-37]
  • Liraglutida
  • Liraglutide (genetical recombination)
  • Liraglutide (rDNA origin)
  • Liraglutide recombinant
  • Liraglutidum
  • N²⁶-(hexadecanoyl-gamma-glutamyle)-[34-arginine]GLP-1-(7-37)-peptide
  • N²⁶-(N-Hexadecanoyl-L-gamma-glutamyl)-[34-L-arginine]glucagon-like peptide 1-(7-37)-peptide
External IDs
NN 2211 / NN-2211 / NN-9924 / NN2211 / NN9924 / NNC 90-1170 / NNC-90-1170
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaSolution6 mgSubcutaneousNovo Nordisk2015-05-27Not applicableCanada
SaxendaInjection, solution6 mg/1mLSubcutaneousNovo Nordisk2014-12-31Not applicableUs
VictozaSolution6 mgSubcutaneousNovo Nordisk2010-05-27Not applicableCanada
VictozaInjection6 mg/1mLSubcutaneousA-S Medication Solutions2010-01-252017-10-31Us
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection6 mg/1mLSubcutaneousNovo Nordisk2010-01-25Not applicableUs
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
XultophyLiraglutide (3.6 mg) + Insulin Degludec (100 unit)SolutionSubcutaneousNovo NordiskNot applicableNot applicableCanada
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
Xultophy 100/3.6Liraglutide (3.6 mg/1mL) + Insulin Degludec (100 [iU]/1mL)Injection, solutionSubcutaneousNovo Nordisk2016-11-21Not applicableUs
Xultophy Pre-filled PenLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
International/Other Brands
Victoza
Categories
UNII
839I73S42A
CAS number
204656-20-2

Pharmacology

Indication

For use in/treatment of diabetes mellitus type 2.

Associated Conditions
Pharmacodynamics

Liraglutide is a once-daily GLP-1 derivative for the treatment of type 2 diabetes. GLP-1, in its natural form, is short-lived in the body (the half-life after subcutaneous injection is approximately one hour), so it is not very useful as a therapeutic agent. However, liraglutide has a half-life after subcutaneous injection of 11–15 hours, making it suitable for once-daily dosing. The prolonged action of liraglutide is achieved by attaching a fatty acid molecule at one position of the GLP-1 molecule, enabling it to bind to albumin within the subcutaneous tissue and bloodstream. The active GLP-1 is then released from albumin at a slow, consistent rate. Binding with albumin also results in slower degradation and reduced elimination of liraglutide from the circulation by the kidneys compared to GLP-1.

Mechanism of action

Liraglutide is an acylated GLP-1 (Glucagon-Like Peptide-1) receptor agonist. Liraglutide upregulates intracellular cAMP resulting in the release of insulin given elevated blood glucose concentrations. Glucagon secretion is also decreased in a glucose-dependent fashion by liraglutide.

TargetActionsOrganism
AGlucagon-like peptide 1 receptor
agonist
Human
Absorption

Maximum concentrations of liraglutide are achieved at 8-12 hours after dose. The mean peak and total exposures of liraglutide were 35 ng/mL and 960 ng·h/mL, respectively, for a subQ single dose of 0.6 mg. After subcutaneous single dose administrations, Cmax and AUC of liraglutide increased proportionally over the therapeutic dose range of 0.6 mg to 1.8 mg. At 1.8 mg Victoza, the average steady state concentration of liraglutide over 24 hours was approximately 128 ng/mL. AUC0-∞ was equivalent between upper arm and abdomen, and between upper arm and thigh. AUC0-∞ from thigh was 22% lower than that from abdomen.
Absolute bioavailability of liraglutide following subcutaneous administration is approximately 55%.

Volume of distribution

SubQ 0.6 mg is approximately 13L Intravenous is approximately 0.07L/kg

Protein binding

>98%

Metabolism

During the initial 24 hours following administration of a single [3H]-liraglutide dose to healthy subjects, the major component in plasma was intact liraglutide. Liraglutide is endogenously metabolized in a similar manner to large proteins without a specific organ as a major route of elimination.

Route of elimination

Excreted in urine and feces, 6% and 5%, respectively.

Half life

approximately 13 hours.

Clearance

The mean apparent clearance following subcutaneous administration of a single dose of liraglutide is approximately 1.2 L/h

Toxicity

In a clinical trial, one patient with type 2 diabetes experienced a single overdose of Victoza 17.4 mg subcutaneous (10 times the maximum recommended dose). Effects of the overdose included severe nausea and vomiting requiring hospitalization. No hypoglycemia was reported. The patient recovered without complications. In the event of overdosage, appropriate supportive treatment should be initiated according to the patient’s clinical signs and symptoms.

RISK OF THYROID C-CELL TUMORS

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
2,4-thiazolidinedioneThe risk or severity of hypoglycemia can be increased when Liraglutide is combined with 2,4-thiazolidinedione.
5-(2-methylpiperazine-1-sulfonyl)isoquinolineThe therapeutic efficacy of Liraglutide can be increased when used in combination with 5-(2-methylpiperazine-1-sulfonyl)isoquinoline.
AcarboseThe risk or severity of hypoglycemia can be increased when Acarbose is combined with Liraglutide.
AcetazolamideThe therapeutic efficacy of Liraglutide can be increased when used in combination with Acetazolamide.
AcetohexamideLiraglutide may increase the hypoglycemic activities of Acetohexamide.
Acetyl sulfisoxazoleThe therapeutic efficacy of Liraglutide can be increased when used in combination with Acetyl sulfisoxazole.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Liraglutide.
AgmatineThe risk or severity of hypoglycemia can be increased when Agmatine is combined with Liraglutide.
AICA ribonucleotideThe risk or severity of hypoglycemia can be increased when AICA ribonucleotide is combined with Liraglutide.
AlaproclateThe risk or severity of hypoglycemia can be increased when Liraglutide is combined with Alaproclate.
Food Interactions
Not Available

References

General References
  1. Russell-Jones D: Molecular, pharmacological and clinical aspects of liraglutide, a once-daily human GLP-1 analogue. Mol Cell Endocrinol. 2009 Jan 15;297(1-2):137-40. doi: 10.1016/j.mce.2008.11.018. Epub 2008 Nov 25. [PubMed:19041364]
  2. Vilsboll T: Liraglutide: a new treatment for type 2 diabetes. Drugs Today (Barc). 2009 Feb;45(2):101-13. doi: 10.1358/dot.2009.45.2.1336104. [PubMed:19343230]
  3. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]
  4. Link [Link]
External Links
UniProt
P01275
KEGG Drug
D06404
PubChem Substance
347910356
ChEBI
71193
ChEMBL
CHEMBL1201866
PharmGKB
PA165958364
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Liraglutide
ATC Codes
A10AE56 — Insulin degludec and liraglutideA10BX07 — Liraglutide
AHFS Codes
  • 68:20.06 — Incretin Mimetics
FDA label
Download (273 KB)
MSDS
Download (569 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
0RecruitingBasic ScienceDiabetes, Diabetes Mellitus Type 11
1CompletedBasic ScienceBMI >30 kg/m21
1CompletedBasic ScienceHealthy Volunteers1
1CompletedBasic ScienceType 2 Diabetes Mellitus2
1CompletedOtherDementias / Insulin Resistance1
1CompletedTreatmentBMI >30 kg/m2 / Healthy Volunteers / Metabolism and Nutrition Disorder2
1CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder5
1CompletedTreatmentDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 11
1CompletedTreatmentDiabetes Mellitus (DM) / Healthy Volunteers14
1CompletedTreatmentDiabetes Mellitus (DM) / Healthy Volunteers / Type 2 Diabetes Mellitus2
1CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus16
1CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent1
1CompletedTreatmentType 2 Diabetes Mellitus1
1RecruitingBasic ScienceType 2 Diabetes Mellitus1
1TerminatedTreatmentDiabetes Mellitus (DM)1
1Unknown StatusTreatmentDiabetes Mellitus (DM)1
1Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
1, 2CompletedTreatmentSleep Apnea Syndrome / Sleep Disordered Breathing (SDB)1
1, 2RecruitingTreatmentDiabetes, Autoimmune / Type1 Diabetes Mellitus1
1, 2RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
2Active Not RecruitingBasic ScienceBMI >30 kg/m21
2Active Not RecruitingTreatmentDiabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 11
2Active Not RecruitingTreatmentImpaired Glucose Tolerance Associated With Drugs1
2Active Not RecruitingTreatmentType 2 Diabetes Mellitus1
2CompletedNot AvailableChronic Stable Angina Pectoris / Coronary Heart Disease (CHD) / Ischaemic Heart Diseases1
2CompletedNot AvailableDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
2CompletedBasic ScienceDiabetes, Diabetes Mellitus Type 11
2CompletedTreatmentAcute Heart Failure (AHF)1
2CompletedTreatmentBMI >30 kg/m22
2CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder2
2CompletedTreatmentCongestive Heart Failure (CHF) / Type 2 Diabetes Mellitus1
2CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus9
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
2CompletedTreatmentNonalcoholic Fatty Liver Disease / Nonalcoholic Steatohepatitis / Type 2 Diabetes Mellitus1
2CompletedTreatmentNonalcoholic Steatohepatitis1
2CompletedTreatmentType 2 Diabetes Mellitus6
2Enrolling by InvitationPreventionDiabetes, Diabetes Mellitus Type 12
2Enrolling by InvitationTreatmentDiabetes, Diabetes Mellitus Type 11
2Not Yet RecruitingTreatmentCessation, Smoking / Weight, Body1
2RecruitingPreventionAutonomic Nervous System Diseases / Diabetic Neuropathy With Neurologic Complication / Sweat Gland Diseases1
2RecruitingTreatmentAlzheimer's Disease (AD)1
2RecruitingTreatmentBMI >30 kg/m22
2RecruitingTreatmentBipolar Disorder (BD) / BMI >30 kg/m21
2RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
2RecruitingTreatmentImpaired Glucose Tolerance (IGT) / Psoriasis / Psoriatic Arthritis / Type 2 Diabetes Mellitus1
2RecruitingTreatmentNeural Development / Obesity, Childhood1
2RecruitingTreatmentParkinson's Disease (PD)1
2RecruitingTreatmentShort Bowel Syndrome (SBS)1
2RecruitingTreatmentType 2 Diabetes Mellitus1
2TerminatedTreatmentDiabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 11
2TerminatedTreatmentType 2 Diabetes Mellitus2
2WithdrawnTreatmentChronic Renal Failure (CRF) / Prediabetic State1
2, 3CompletedTreatmentDiabetes Mellitus (DM)1
2, 3CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
2, 3CompletedTreatmentMaturity-Onset Diabetes of the Young1
2, 3Enrolling by InvitationTreatmentDiabetes, Diabetes Mellitus Type 11
2, 3Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
3Active Not RecruitingPreventionDisorder of Glucose Regulation / Gestational Diabetes Mellitus (GDM) / Impaired Glucose Tolerance (IGT) / Metabolic Syndromes / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
3Active Not RecruitingTreatmentComparative Effectiveness of Glycemia-lowering Medications / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentPre-Diabetic / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentType 2 Diabetes Mellitus1
3CompletedBasic ScienceType 2 Diabetes Mellitus1
3CompletedPreventionOlder Adults / Pre-Diabetic1
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder5
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder / Obstructive Sleep Apnoea (OSA)1
3CompletedTreatmentBipolar Disorder (BD) / Major Depressive Disorder (MDD)1
3CompletedTreatmentCardiovascular Disease (CVD) / Type 2 Diabetes Mellitus1
3CompletedTreatmentDiabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 13
3CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus28
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
3CompletedTreatmentDiabetic Kidney Disease1
3CompletedTreatmentType 2 Diabetes Mellitus5
3Not Yet RecruitingTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
3Not Yet RecruitingTreatmentType 2 Diabetes Mellitus2
3RecruitingNot AvailableDiabetes, Diabetes Mellitus Type 11
3RecruitingOtherBMI >30 kg/m21
3RecruitingTreatmentBMI >30 kg/m22
3RecruitingTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
3RecruitingTreatmentBrain Death1
3RecruitingTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
3RecruitingTreatmentDiabetes, Diabetes Mellitus Type 13
3RecruitingTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Non-Alcoholic Steatohepatitis (NASH) / Obese experiencing rapid weight loss1
3RecruitingTreatmentObesity Android / Polycystic Ovaries Syndrome / Pre Diabetes1
3RecruitingTreatmentType 2 Diabetes Mellitus1
3TerminatedTreatmentBMI >30 kg/m21
3TerminatedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
3TerminatedTreatmentType 2 Diabetes Mellitus1
3Unknown StatusPreventionGlucocorticoid Induced Hyperglycemia1
3WithdrawnTreatmentDiabetes, Diabetes Mellitus Type 11
4Active Not RecruitingNot AvailableType 2 Diabetes Mellitus1
4Active Not RecruitingBasic ScienceInsulin Resistance1
4Active Not RecruitingPreventionGestational Diabetes Mellitus (GDM)1
4Active Not RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Masked Hypertension / Type 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentBMI >30 kg/m21
4Active Not RecruitingTreatmentBMI >30 kg/m2 / Diabesity / Type 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentBMI >30 kg/m2 / Osteoarthritis (OA)2
4Active Not RecruitingTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentKnee Osteoarthritis (Knee OA)1
4Active Not RecruitingTreatmentType 2 Diabetes Mellitus1
4CompletedBasic ScienceDiabetes Mellitus (DM) / Effects of Liraglutide Administration on Brain Activity / Hunger / Obese experiencing rapid weight loss1
4CompletedBasic ScienceHealthy Human Male Subjects1
4CompletedBasic ScienceSystolic Hypertension / Type 2 Diabetes Mellitus1
4CompletedOtherBariatric Surgery Candidate / Obesity, Morbid1
4CompletedSupportive CareAcromegaly / Cushing's Disease1
4CompletedTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Type 2 Diabetes Mellitus1
4CompletedTreatmentBMI >27 kg/m2 / Diabetes, Diabetes Mellitus Type 11
4CompletedTreatmentBMI >30 kg/m2 / General Surgery / Hypoglycemia1
4CompletedTreatmentBMI >30 kg/m2 / Hypogonadism1
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovarian Syndrome5
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovaries Syndrome1
4CompletedTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
4CompletedTreatmentBinge Eating Behaviour1
4CompletedTreatmentCardiovascular Disease (CVD) / Diastolic Dysfunction / Fatty Liver / Metabolic Syndromes / Type 2 Diabetes Mellitus2
4CompletedTreatmentCardiovascular Disease (CVD) / Polycystic Ovaries Syndrome1
4CompletedTreatmentCoronary Artery Disease / Type 2 Diabetes Mellitus1
4CompletedTreatmentDIABETES Mellitus Type 2 Not Well Controlled1
4CompletedTreatmentDiabetes Complications / Osteoporosis1
4CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus5
4CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent / Hypertensive Disease1
4CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
4CompletedTreatmentDiabetic Kidney Disease1
4CompletedTreatmentEnd-Stage Renal Disease (ESRD) / Type 2 Diabetes Mellitus1
4CompletedTreatmentHealthy Volunteers1
4CompletedTreatmentMicrovascular Dysfunction / Type 2 Diabetes Mellitus1
4CompletedTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD)1
4CompletedTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Type2 Diabetes1
4CompletedTreatmentType 2 Diabetes Mellitus9
4Not Yet RecruitingBasic ScienceType 2 Diabetes Mellitus1
4Not Yet RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Monoclonal Gammopathy1
4Not Yet RecruitingTreatmentBMI >30 kg/m21
4RecruitingNot AvailableBMI >27 kg/m2 / Type 2 Diabetes Mellitus1
4RecruitingBasic ScienceBMI >30 kg/m2 / Pre-Diabetic1
4RecruitingBasic ScienceDiabetes Mellitus, Adult-Onset / Inflammatory Reaction / Type 2 Diabetes Mellitus1
4RecruitingOtherBMI >30 kg/m21
4RecruitingPreventionCardiovascular Disease (CVD) / Lipid Metabolism Disorders / Obesity, Visceral1
4RecruitingPreventionPre-Diabetic1
4RecruitingPreventionType 2 Diabetes Mellitus1
4RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Human Immunodeficiency Virus (HIV) Infections / Metabolic Syndromes / Type 2 Diabetes Mellitus1
4RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Polycystic Ovary Syndrome (PCOS)1
4RecruitingTreatmentBMI >30 kg/m21
4RecruitingTreatmentBMI >30 kg/m2 / Diabetes Mellitus (DM) / Obese experiencing rapid weight loss1
4RecruitingTreatmentBMI >30 kg/m2 / Osteoarthritis (OA)2
4RecruitingTreatmentCardiac MRI / Diastolic Dysfunction / Myocardial Perfusion / Type 2 Diabetes Mellitus1
4RecruitingTreatmentCoronary Artery Disease / Type2 Diabetes1
4RecruitingTreatmentDiabetes Mellitus (DM)1
4RecruitingTreatmentDiabetes, Autoimmune / Diabetes, Diabetes Mellitus Type 11
4RecruitingTreatmentGLP-1;Telomere-telomerase System; Par-4 / GLP-1;Metformin;Telomere-telomerase System;Par-41
4RecruitingTreatmentMicrovascular Angina1
4RecruitingTreatmentPulmonary Disease, Chronic Obstructive1
4RecruitingTreatmentType 2 Diabetes Mellitus4
4RecruitingTreatmentType 2 Diabetes Patients1
4RecruitingTreatmentType II Diabetes in Subjects BMI 27 to 32 / Type II Diabetes in the Not so Obese1
4TerminatedTreatmentGastric Banding / Type 2 Diabetes Mellitus1
4TerminatedTreatmentPrader Willi Syndrome / Type 2 Diabetes Mellitus1
4TerminatedTreatmentType 2 Diabetes Mellitus2
4Unknown StatusTreatmentType 2 Diabetes Mellitus1
4Unknown StatusTreatmentUncontrolled Type 1 Diabetic Patients1
4WithdrawnNot AvailableType 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus11
Not AvailableCompletedNot AvailableDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedNot AvailableDiabetic Nephropathies / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableType 2 Diabetes Mellitus4
Not AvailableCompletedBasic ScienceDiabetes Mellitus (DM)1
Not AvailableCompletedBasic ScienceType 2 Diabetes Mellitus1
Not AvailableCompletedDiagnosticBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedHealth Services ResearchBMI >27 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedOtherType 2 Diabetes Mellitus1
Not AvailableCompletedTreatmentAlzheimers Disease1
Not AvailableCompletedTreatmentChronic Heart Failure (CHF) / Hyperglycemias1
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentType 2 Diabetes Mellitus1
Not AvailableEnrolling by InvitationNot AvailableBMI >27 kg/m2 / BMI >30 kg/m21
Not AvailableEnrolling by InvitationNot AvailableBMI >30 kg/m2 / Metabolism and Nutrition Disorder2
Not AvailableEnrolling by InvitationTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableEnrolling by InvitationTreatmentIschaemic Cardiomyopathy1
Not AvailableNot Yet RecruitingTreatmentType 2 Diabetes Mellitus1
Not AvailableRecruitingNot AvailableBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
Not AvailableRecruitingBasic ScienceBMI >30 kg/m21
Not AvailableRecruitingOtherType 2 Diabetes Mellitus1
Not AvailableRecruitingPreventionIncretinomimetics / Pancreas / Type 2 Diabetes Mellitus1
Not AvailableRecruitingTreatmentAcute Myocardial Infarction (AMI)1
Not AvailableRecruitingTreatmentAcute ST-segment Elevation Myocardial Infarction1
Not AvailableRecruitingTreatmentCoronary Artery Disease / Diabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
Not AvailableRecruitingTreatmentHeart Failure, Unspecified2
Not AvailableRecruitingTreatmentMyocardial Infarction1
Not AvailableRecruitingTreatmentType 2 Diabetes Mellitus2
Not AvailableUnknown StatusNot AvailableReduction of Psoriasis Following Liraglutide Therapy in Terms of PASI and DLQI1
Not AvailableUnknown StatusTreatmentType 2 Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous6 mg/1mL
Injection, solutionSubcutaneous6 mg/ml
InjectionSubcutaneous6 mg/1mL
SolutionSubcutaneous6 mg
Injection, solutionSubcutaneous
SolutionSubcutaneous
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2264243No2004-10-052017-08-22Canada
US8672898No2014-03-182022-01-02Us
US8684969No2014-04-012025-10-20Us
US9132239No2015-09-152032-02-01Us
US8920383No2014-12-302026-07-17Us
US7686786No2010-03-302026-08-03Us
US6899699No2005-05-312022-01-02Us
US9108002No2015-08-182026-01-20Us
USRE41956Yes2010-11-232021-07-21Us
US9265893No2016-02-232032-09-23Us
US6004297Yes1999-12-212019-07-28Us
USRE43834No2012-11-272019-01-28Us
US6458924No2002-10-012017-08-22Us
US6268343No2001-07-312022-08-22Us
US8846618No2014-09-302022-06-27Us
US8114833No2012-02-142025-08-13Us
US7235627No2007-06-262017-08-22Us
US7615532No2009-11-102025-05-25Us
US9486588No2016-11-082022-01-02Us
US9457154No2016-10-042027-09-27Us
USRE46363No2017-04-112026-08-03Us
US8937042No2015-01-202029-05-05Us
US9687611No2017-06-272027-02-27Us
US9775953No2017-10-032026-07-17Us
US9968659No2018-05-152037-01-09Us
US9861757No2018-01-092026-01-20Us
US9616180No2017-04-112026-01-20Us

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Transmembrane signaling receptor activity
Specific Function
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name
GLP1R
Uniprot ID
P43220
Uniprot Name
Glucagon-like peptide 1 receptor
Molecular Weight
53025.22 Da
References
  1. Bock T, Pakkenberg B, Buschard K: The endocrine pancreas in non-diabetic rats after short-term and long-term treatment with the long-acting GLP-1 derivative NN2211. APMIS. 2003 Dec;111(12):1117-24. [PubMed:14678021]
  2. Larsen PJ, Wulff EM, Gotfredsen CF, Brand CL, Sturis J, Vrang N, Knudsen LB, Lykkegaard K: Combination of the insulin sensitizer, pioglitazone, and the long-acting GLP-1 human analog, liraglutide, exerts potent synergistic glucose-lowering efficacy in severely diabetic ZDF rats. Diabetes Obes Metab. 2008 Apr;10(4):301-11. doi: 10.1111/j.1463-1326.2008.00865.x. [PubMed:18333889]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Substrate
General Function
Virus receptor activity
Specific Function
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by bindi...
Gene Name
DPP4
Uniprot ID
P27487
Uniprot Name
Dipeptidyl peptidase 4
Molecular Weight
88277.935 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Substrate
General Function
Zinc ion binding
Specific Function
Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids (PubMed:15283675, PubMed:8168535). Biologically important in the destruction of opioid peptide...
Gene Name
MME
Uniprot ID
P08473
Uniprot Name
Neprilysin
Molecular Weight
85513.225 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]

Drug created on March 19, 2008 10:45 / Updated on November 17, 2018 04:48