Identification

Name
Liraglutide
Accession Number
DB06655
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones
Description

Victoza contains liraglutide, an analog of human GLP-1 and acts as a GLP-1 receptor agonist. The peptide precursor of liraglutide, produced by a process that includes expression of recombinant DNA in Saccharomyces cerevisiae, has been engineered to be 97% homologous to native human GLP-1 by substituting arginine for lysine at position 34. Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor.

Protein chemical formula
C172H265N43O51
Protein average weight
3751.2 Da
Sequences
>Liraglutide Sequence
HAEGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
Download FASTA Format
Synonyms
  • Arg34Lys26-(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-1[7-37]
  • Liraglutida
  • Liraglutide recombinant
  • Liraglutidum
  • N²⁶-(hexadecanoyl-gamma-glutamyle)-[34-arginine]GLP-1-(7-37)-peptide
  • N²⁶-(N-Hexadecanoyl-L-gamma-glutamyl)-[34-L-arginine]glucagon-like peptide 1-(7-37)-peptide
  • NN 2211
  • NN-2211
  • NN2211
  • NNC 90-1170
External IDs
NN 2211 / UNII-839I73S42A
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaSolution6 mgSubcutaneousNovo Nordisk2015-05-27Not applicableCanada
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mLSubcutaneousNovo Nordisk2014-12-31Not applicableUs
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
VictozaInjection6 mg/mLSubcutaneousNovo Nordisk2010-01-25Not applicableUs
VictozaSolution6 mgSubcutaneousNovo Nordisk2010-05-27Not applicableCanada
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection6 mg/mLSubcutaneousA S Medication Solutions2010-01-252017-06-20Us
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
International/Other Brands
Victoza
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
Xultophy Pre-filled PenLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
Xultophy 100/3.6Liraglutide (3.6 mg/mL) + Insulin Degludec (100 [iU]/mL)Injection, solutionSubcutaneousNovo Nordisk2016-11-21Not applicableUs
Categories
UNII
839I73S42A
CAS number
204656-20-2

Pharmacology

Indication

For use in/treatment of diabetes mellitus type 2.

Structured Indications
Pharmacodynamics

Liraglutide is a once-daily GLP-1 derivative for the treatment of type 2 diabetes. GLP-1, in its natural form, is short-lived in the body (the half-life after subcutaneous injection is approximately one hour), so it is not very useful as a therapeutic agent. However, liraglutide has a half-life after subcutaneous injection of 11–15 hours, making it suitable for once-daily dosing. The prolonged action of liraglutide is achieved by attaching a fatty acid molecule at one position of the GLP-1 molecule, enabling it to bind to albumin within the subcutaneous tissue and bloodstream. The active GLP-1 is then released from albumin at a slow, consistent rate. Binding with albumin also results in slower degradation and reduced elimination of liraglutide from the circulation by the kidneys compared to GLP-1.

Mechanism of action

Liraglutide is an acylated GLP-1 (Glucagon-Like Peptide-1) receptor agonist. Liraglutide upregulates intracellular cAMP resulting in the release of insulin given elevated blood glucose concentrations. Glucagon secretion is also decreased in a glucose-dependent fashion by liraglutide.

TargetActionsOrganism
AGlucagon-like peptide 1 receptor
agonist
Human
Absorption

Maximum concentrations of liraglutide are achieved at 8-12 hours after dose. The mean peak and total exposures of liraglutide were 35 ng/mL and 960 ng·h/mL, respectively, for a subQ single dose of 0.6 mg. After subcutaneous single dose administrations, Cmax and AUC of liraglutide increased proportionally over the therapeutic dose range of 0.6 mg to 1.8 mg. At 1.8 mg Victoza, the average steady state concentration of liraglutide over 24 hours was approximately 128 ng/mL. AUC0-∞ was equivalent between upper arm and abdomen, and between upper arm and thigh. AUC0-∞ from thigh was 22% lower than that from abdomen.
Absolute bioavailability of liraglutide following subcutaneous administration is approximately 55%.

Volume of distribution

SubQ 0.6 mg is approximately 13L Intravenous is approximately 0.07L/kg

Protein binding

>98%

Metabolism

During the initial 24 hours following administration of a single [3H]-liraglutide dose to healthy subjects, the major component in plasma was intact liraglutide. Liraglutide is endogenously metabolized in a similar manner to large proteins without a specific organ as a major route of elimination.

Route of elimination

Excreted in urine and feces, 6% and 5%, respectively.

Half life

approximately 13 hours.

Clearance

The mean apparent clearance following subcutaneous administration of a single dose of liraglutide is approximately 1.2 L/h

Toxicity

In a clinical trial, one patient with type 2 diabetes experienced a single overdose of Victoza 17.4 mg subcutaneous (10 times the maximum recommended dose). Effects of the overdose included severe nausea and vomiting requiring hospitalization. No hypoglycemia was reported. The patient recovered without complications. In the event of overdosage, appropriate supportive treatment should be initiated according to the patient’s clinical signs and symptoms.

RISK OF THYROID C-CELL TUMORS

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline may increase the hypoglycemic activities of Liraglutide.Experimental
AcetohexamideLiraglutide may increase the hypoglycemic activities of Acetohexamide.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
AlaproclateAlaproclate may increase the hypoglycemic activities of Liraglutide.Experimental
AloxiprinAloxiprin may increase the hypoglycemic activities of Liraglutide.Experimental
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Liraglutide.Approved
AripiprazoleThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Atazanavir.Approved, Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
BendroflumethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Liraglutide.Withdrawn
BetamethasoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrexpiprazoleThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Brexpiprazole.Approved
BrofaromineBrofaromine may increase the hypoglycemic activities of Liraglutide.Experimental
BumetanideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Buserelin.Approved
Carbaspirin calciumCarbaspirin calcium may increase the hypoglycemic activities of Liraglutide.Experimental
CarbutamideLiraglutide may increase the hypoglycemic activities of Carbutamide.Experimental
CaroxazoneCaroxazone may increase the hypoglycemic activities of Liraglutide.Withdrawn
CeritinibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorpropamideLiraglutide may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Chlorthalidone.Approved
CinoxacinCinoxacin may increase the hypoglycemic activities of Liraglutide.Approved, Withdrawn
CitalopramCitalopram may increase the hypoglycemic activities of Liraglutide.Approved
ClozapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Cortisone acetate.Approved
CyclopenthiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Cyclopenthiazide.Experimental
Cyproterone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Liraglutide.Investigational
DarunavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Darunavir.Approved
dersalazinedersalazine may increase the hypoglycemic activities of Liraglutide.Investigational
DesogestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Liraglutide.Approved
DexamethasoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DiazoxideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Diazoxide.Approved
DienogestThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Liraglutide.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Liraglutide.Illicit
DisopyramideLiraglutide may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Drospirenone.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Liraglutide.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Liraglutide.Approved
EpinephrineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
EstradiolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ethinyl Estradiol.Approved
Ethynodiol diacetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Liraglutide.Approved
EverolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Everolimus.Approved
FleroxacinFleroxacin may increase the hypoglycemic activities of Liraglutide.Approved
FludrocortisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Liraglutide.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Liraglutide.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
FurosemideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Furosemide.Approved, Vet Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Liraglutide.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
GlibornurideLiraglutide may increase the hypoglycemic activities of Glibornuride.Withdrawn
GliclazideLiraglutide may increase the hypoglycemic activities of Gliclazide.Approved
GlimepirideLiraglutide may increase the hypoglycemic activities of Glimepiride.Approved
GlipizideLiraglutide may increase the hypoglycemic activities of Glipizide.Approved
GliquidoneLiraglutide may increase the hypoglycemic activities of Gliquidone.Approved
GlisoxepideLiraglutide may increase the hypoglycemic activities of Glisoxepide.Approved
GLPG-0492GLPG-0492 may increase the hypoglycemic activities of Liraglutide.Investigational
GlyburideLiraglutide may increase the hypoglycemic activities of Glyburide.Approved
GoserelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Liraglutide.Withdrawn
GuacetisalGuacetisal may increase the hypoglycemic activities of Liraglutide.Experimental
HarmalineHarmaline may increase the hypoglycemic activities of Liraglutide.Experimental
Hemoglobin crosfumarilHemoglobin crosfumaril may increase the hypoglycemic activities of Liraglutide.Experimental
HistrelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Histrelin.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Liraglutide.Experimental
HydrochlorothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydroflumethiazide.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
IloperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Liraglutide.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Indinavir.Approved
Insulin AspartLiraglutide may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirLiraglutide may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineLiraglutide may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisineLiraglutide may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanLiraglutide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
Insulin LisproLiraglutide may increase the hypoglycemic activities of Insulin Lispro.Approved
Insulin PorkLiraglutide may increase the hypoglycemic activities of Insulin Pork.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Liraglutide.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Liraglutide.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Liraglutide.Approved
LanreotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Liraglutide.Approved
LevonorgestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Levonorgestrel.Approved, Investigational
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Liraglutide.Approved, Nutraceutical
LopinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
MecaserminLiraglutide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Liraglutide.Approved
MesteroloneMesterolone may increase the hypoglycemic activities of Liraglutide.Experimental
MestranolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Mestranol.Approved
MetahexamideLiraglutide may increase the hypoglycemic activities of Metahexamide.Experimental
MethotrimeprazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methyclothiazide.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Liraglutide.Investigational
MethylprednisoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Liraglutide.Approved
MetolazoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Metolazone.Approved
MifepristoneLiraglutide may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MilnacipranMilnacipran may increase the hypoglycemic activities of Liraglutide.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Liraglutide.Approved
MoclobemideMoclobemide may increase the hypoglycemic activities of Liraglutide.Approved
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Liraglutide.Approved
NandroloneNandrolone may increase the hypoglycemic activities of Liraglutide.Experimental
NateglinideLiraglutide may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Liraglutide.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Liraglutide.Investigational
NiacinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Liraglutide.Withdrawn
NilotinibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Liraglutide.Investigational
NorethisteroneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Liraglutide.Approved
NorgestimateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Liraglutide.Withdrawn
OctreotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Octreotide.Approved, Investigational
OlanzapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Liraglutide.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
Oxolinic acidOxolinic acid may increase the hypoglycemic activities of Liraglutide.Experimental
OxymetholoneOxymetholone may increase the hypoglycemic activities of Liraglutide.Approved, Illicit
PaliperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Paliperidone.Approved
PargylinePargyline may increase the hypoglycemic activities of Liraglutide.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
PasireotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Liraglutide.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Liraglutide.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Liraglutide.Approved
PentamidineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pentamidine.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Liraglutide.Approved
PheniprazinePheniprazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
Pipemidic acidPipemidic acid may increase the hypoglycemic activities of Liraglutide.Experimental
PiperazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pipotiazine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Liraglutide.Approved
Piromidic acidPiromidic acid may increase the hypoglycemic activities of Liraglutide.Experimental
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
PolythiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Polythiazide.Approved
PrednisoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProgesteroneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Progesterone.Approved, Vet Approved
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Liraglutide.Investigational
QuetiapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Quinethazone.Approved
QuinineLiraglutide may increase the hypoglycemic activities of Quinine.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Liraglutide.Approved
RepaglinideLiraglutide may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RisperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ritonavir.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Liraglutide.Approved
RufloxacinRufloxacin may increase the hypoglycemic activities of Liraglutide.Experimental
SafrazineSafrazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Saquinavir.Approved, Investigational
SelegilineSelegiline may increase the hypoglycemic activities of Liraglutide.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Liraglutide.Approved
SirolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Sirolimus.Approved, Investigational
SitafloxacinSitafloxacin may increase the hypoglycemic activities of Liraglutide.Experimental
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Liraglutide.Approved
StanozololStanozolol may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
SulfadiazineLiraglutide may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazoleLiraglutide may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazoleLiraglutide may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SunitinibLiraglutide may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Liraglutide.Withdrawn
TemsirolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
TipranavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamideLiraglutide may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamideLiraglutide may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Liraglutide.Approved
TorasemideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Liraglutide.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Liraglutide.Approved
TriamcinoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TriptorelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Liraglutide.Approved
VorinostatThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Liraglutide.Withdrawn
ZiprasidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ziprasidone.Approved
Food Interactions
Not Available

References

General References
  1. Russell-Jones D: Molecular, pharmacological and clinical aspects of liraglutide, a once-daily human GLP-1 analogue. Mol Cell Endocrinol. 2009 Jan 15;297(1-2):137-40. doi: 10.1016/j.mce.2008.11.018. Epub 2008 Nov 25. [PubMed:19041364]
  2. Vilsboll T: Liraglutide: a new treatment for type 2 diabetes. Drugs Today (Barc). 2009 Feb;45(2):101-13. doi: 10.1358/dot.2009.45.2.1336104. [PubMed:19343230]
  3. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]
  4. Link [Link]
External Links
UniProt
P01275
KEGG Drug
D06404
ChEBI
71193
ChEMBL
CHEMBL1201866
PharmGKB
PA165958364
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Liraglutide
ATC Codes
A10BX07 — LiraglutideA10AE56 — Insulin degludec and liraglutide
AHFS Codes
  • 68:20.06 — Incretin Mimetics
FDA label
Download (273 KB)
MSDS
Download (569 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
1Active Not RecruitingTreatmentDiabetes Mellitus (DM)1
1CompletedBasic ScienceHealthy Volunteers1
1CompletedBasic ScienceType 2 Diabetes Mellitus1
1CompletedTreatmentBMI >30 kg/m2 / Healthy Volunteers / Metabolism and Nutrition Disorder2
1CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder5
1CompletedTreatmentDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent1
1CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 11
1CompletedTreatmentDiabetes / Healthy Volunteers14
1CompletedTreatmentDiabetes / Healthy Volunteers / Type 2 Diabetes Mellitus1
1CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus15
1CompletedTreatmentType 2 Diabetes Mellitus1
1Not Yet RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus1
1RecruitingBasic ScienceBMI >30 kg/m21
1RecruitingBasic ScienceType 2 Diabetes Mellitus2
1Unknown StatusTreatmentDiabetes Mellitus (DM)1
1Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
1, 2CompletedTreatmentSleep Apnea Syndrome / Sleep Disordered Breathing (SDB)1
1, 2Not Yet RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
1, 2RecruitingTreatmentDiabetes, Autoimmune / Type1 Diabetes Mellitus1
2Active Not RecruitingBasic ScienceBMI >30 kg/m21
2Active Not RecruitingTreatmentBMI >30 kg/m21
2Active Not RecruitingTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 11
2Active Not RecruitingTreatmentImpaired Glucose Tolerance Associated With Drugs1
2CompletedNot AvailableChronic, stable Angina pectoris / Coronary Heart Disease (CHD) / Ischaemic Heart Diseases1
2CompletedNot AvailableDiabetes / Type 2 Diabetes Mellitus1
2CompletedBasic ScienceDiabetes, Diabetes Mellitus Type 11
2CompletedTreatmentAcute Heart Failure (AHF)1
2CompletedTreatmentBMI >30 kg/m21
2CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder2
2CompletedTreatmentCongestive Heart Failure (CHF) / Type 2 Diabetes Mellitus1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
2CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus9
2CompletedTreatmentNonalcoholic Fatty Liver Disease / Nonalcoholic Steatohepatitis / Type 2 Diabetes Mellitus1
2CompletedTreatmentNonalcoholic Steatohepatitis1
2CompletedTreatmentType 2 Diabetes Mellitus5
2Enrolling by InvitationPreventionDiabetes, Diabetes Mellitus Type 12
2Enrolling by InvitationTreatmentDiabetes, Diabetes Mellitus Type 11
2RecruitingTreatmentAlzheimer's Disease (AD)1
2RecruitingTreatmentBipolar Disorder (BD) / BMI >30 kg/m21
2RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
2RecruitingTreatmentImpaired Glucose Tolerance (IGT) / Psoriasis / Psoriatic Arthritis / Type 2 Diabetes Mellitus1
2RecruitingTreatmentParkinson's Disease (PD)1
2RecruitingTreatmentType 2 Diabetes Mellitus2
2TerminatedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 11
2TerminatedTreatmentType 2 Diabetes Mellitus2
2WithdrawnTreatmentKidney Failure,Chronic / Prediabetic State1
2, 3CompletedTreatmentDiabetes Mellitus (DM)1
2, 3CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
2, 3CompletedTreatmentMaturity-Onset Diabetes of the Young1
2, 3Enrolling by InvitationTreatmentDiabetes, Diabetes Mellitus Type 11
2, 3Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
3Active Not RecruitingTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
3Active Not RecruitingTreatmentComparative Effectiveness of Glycemia-lowering Medications / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus5
3CompletedBasic ScienceType 2 Diabetes Mellitus1
3CompletedPreventionOlder Adults / Pre-Diabetic1
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder3
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder / Obstructive Sleep Apnoea (OSA)1
3CompletedTreatmentBipolar Disorder (BD) / Major Depressive Disorder (MDD)1
3CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
3CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 13
3CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus20
3CompletedTreatmentDiabetic Kidney Disease1
3CompletedTreatmentType 2 Diabetes Mellitus5
3Not Yet RecruitingTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
3RecruitingNot AvailableDiabetes, Diabetes Mellitus Type 11
3RecruitingOtherBMI >30 kg/m21
3RecruitingPreventionDisorder of Glucose Regulation / Gestational Diabetes Mellitus (GDM) / Impaired Glucose Tolerance (IGT) / Metabolic Syndromes / Type 2 Diabetes Mellitus1
3RecruitingTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder3
3RecruitingTreatmentCardiovascular Disease (CVD) / Type 2 Diabetes Mellitus1
3RecruitingTreatmentDiabetes, Diabetes Mellitus Type 13
3RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus3
3RecruitingTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Non-Alcoholic Steatohepatitis (NASH) / Obese experiencing rapid weight loss1
3RecruitingTreatmentPre-Diabetic / Type 2 Diabetes Mellitus1
3RecruitingTreatmentType 2 Diabetes Mellitus2
3TerminatedTreatmentBMI >30 kg/m21
3TerminatedTreatmentDiabetes / Type 2 Diabetes Mellitus1
3TerminatedTreatmentType 2 Diabetes Mellitus1
3Unknown StatusPreventionGlucocorticoid Induced Hyperglycemia1
3WithdrawnTreatmentDiabetes, Diabetes Mellitus Type 11
4Active Not RecruitingNot AvailableType 2 Diabetes Mellitus1
4Active Not RecruitingBasic ScienceInsulin Resistance1
4Active Not RecruitingPreventionGestational Diabetes Mellitus (GDM)1
4Active Not RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Masked Hypertension / Type 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentBMI >30 kg/m2 / Diabesity / Type 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus1
4CompletedBasic ScienceDiabetes / Effects of Liraglutide Administration on Brain Activity / Hunger / Obese experiencing rapid weight loss1
4CompletedBasic ScienceHealthy Human Male Subjects1
4CompletedBasic ScienceSystolic Hypertension / Type 2 Diabetes Mellitus1
4CompletedTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Type 2 Diabetes Mellitus1
4CompletedTreatmentBMI >27 kg/m2 / Diabetes, Diabetes Mellitus Type 11
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovarian Syndrome5
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovaries Syndrome1
4CompletedTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
4CompletedTreatmentBinge Eating Behaviour1
4CompletedTreatmentCardiovascular Disease (CVD) / Diastolic Dysfunction / Fatty Liver / Metabolic Syndromes / Type 2 Diabetes Mellitus1
4CompletedTreatmentCardiovascular Disease (CVD) / Polycystic Ovaries Syndrome1
4CompletedTreatmentCoronary Artery Disease / Type 2 Diabetes Mellitus1
4CompletedTreatmentDIABETES Mellitus Type 2 Not Well Controlled1
4CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent / Hypertensive Disease1
4CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus4
4CompletedTreatmentDiabetic Kidney Disease1
4CompletedTreatmentEnd-Stage Renal Disease (ESRD) / Type 2 Diabetes Mellitus1
4CompletedTreatmentHealthy Volunteers1
4CompletedTreatmentMicrovascular Dysfunction / Type 2 Diabetes Mellitus1
4CompletedTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Type2 Diabetes1
4CompletedTreatmentType 2 Diabetes Mellitus8
4Enrolling by InvitationTreatmentBMI >30 kg/m2 / General Surgery / Hypoglycemia1
4Not Yet RecruitingBasic ScienceType 2 Diabetes Mellitus1
4Not Yet RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Monoclonal Gammopathy1
4Not Yet RecruitingTreatmentBMI >30 kg/m2 / Diabetes Mellitus (DM) / Obese experiencing rapid weight loss1
4Not Yet RecruitingTreatmentCoronary Artery Disease / Type2 Diabetes1
4RecruitingNot AvailableBMI >27 kg/m2 / Type 2 Diabetes Mellitus1
4RecruitingBasic ScienceBMI >30 kg/m2 / Pre-Diabetic1
4RecruitingBasic ScienceDiabetes Mellitus, Adult-Onset / Inflammatory Reaction / Type 2 Diabetes Mellitus1
4RecruitingOtherBMI >30 kg/m21
4RecruitingOtherBariatric Surgery Candidate / Obesity, Morbid1
4RecruitingPreventionCardiovascular Disease (CVD) / Lipid Metabolism Disorders / Obesity, Visceral1
4RecruitingPreventionPre-Diabetic1
4RecruitingSupportive CareAcromegaly / Cushing's Disease1
4RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Human Immunodeficiency Virus (HIV) Infections / Metabolic Syndromes / Type 2 Diabetes Mellitus1
4RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Polycystic Ovary Syndrome (PCOS)1
4RecruitingTreatmentBMI >30 kg/m22
4RecruitingTreatmentBMI >30 kg/m2 / Synovitis of osteoarthritis4
4RecruitingTreatmentCardiac MRI / Diastolic Dysfunction / Myocardial Perfusion / Type 2 Diabetes Mellitus1
4RecruitingTreatmentCardiovascular Disease (CVD) / Diastolic Dysfunction / Fatty Liver / Metabolic Syndromes / Type 2 Diabetes Mellitus1
4RecruitingTreatmentBone destruction / Diabetes Complications1
4RecruitingTreatmentDiabetes Mellitus (DM)1
4RecruitingTreatmentDiabetes, Autoimmune / Diabetes, Diabetes Mellitus Type 11
4RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus1
4RecruitingTreatmentGLP-1;Telomere-telomerase System; Par-4 / GLP-1;Metformin;Telomere-telomerase System;Par-41
4RecruitingTreatmentMicrovascular Angina1
4RecruitingTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD)1
4RecruitingTreatmentOsteoarthritis of the Knees1
4RecruitingTreatmentType 2 Diabetes Mellitus6
4RecruitingTreatmentType 2 Diabetes Patients1
4RecruitingTreatmentType II Diabetes in Subjects BMI 27 to 32 / Type II Diabetes in the Not so Obese1
4TerminatedTreatmentPrader Willi Syndrome / Type 2 Diabetes Mellitus1
4TerminatedTreatmentType 2 Diabetes Mellitus2
4Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
4Unknown StatusTreatmentGastric Banding / Type 2 Diabetes Mellitus1
4Unknown StatusTreatmentType 2 Diabetes Mellitus1
4Unknown StatusTreatmentUncontrolled Type 1 Diabetic Patients1
4WithdrawnNot AvailableType 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedNot AvailableDiabetes / Type 2 Diabetes Mellitus11
Not AvailableCompletedNot AvailableDiabetic Nephropathies / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableType 2 Diabetes Mellitus4
Not AvailableCompletedBasic ScienceType 2 Diabetes Mellitus1
Not AvailableCompletedDiagnosticBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedHealth Services ResearchBMI >27 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedOtherDementias / Insulin Resistance1
Not AvailableCompletedTreatmentAlzheimers Disease1
Not AvailableCompletedTreatmentChronic Heart Failure (CHF) / Hyperglycemias1
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentType 2 Diabetes Mellitus1
Not AvailableEnrolling by InvitationNot AvailableBMI >30 kg/m21
Not AvailableEnrolling by InvitationTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableEnrolling by InvitationTreatmentIschaemic Cardiomyopathy1
Not AvailableNot Yet RecruitingTreatmentType 2 Diabetes Mellitus1
Not AvailableRecruitingNot AvailableType 2 Diabetes Mellitus1
Not AvailableRecruitingOtherType 2 Diabetes Mellitus1
Not AvailableRecruitingPreventionIncretinomimetics / Pancreas / Type 2 Diabetes Mellitus1
Not AvailableRecruitingTreatmentAcute Myocardial Infarction (AMI)1
Not AvailableRecruitingTreatmentAcute ST-segment Elevation Myocardial Infarction1
Not AvailableRecruitingTreatmentCoronary Artery Disease / Diabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
Not AvailableRecruitingTreatmentHeart Failure, Unspecified2
Not AvailableRecruitingTreatmentMyocardial Infarction (MI)1
Not AvailableRecruitingTreatmentType 2 Diabetes Mellitus1
Not AvailableUnknown StatusNot AvailableReduction of Psoriasis Following Liraglutide Therapy in Terms of PASI and DLQI1
Not AvailableUnknown StatusBasic ScienceDiabetes1
Not AvailableUnknown StatusTreatmentType 2 Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous6 mg/ml
InjectionSubcutaneous6 mg/mL
SolutionSubcutaneous6 mg
Injection, solutionSubcutaneous
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2264243No2004-10-052017-08-22Canada
US8672898No2002-01-022022-01-02Us
US8684969No2005-10-202025-10-20Us
US9132239No2012-02-012032-02-01Us
US8920383No2006-07-172026-07-17Us
US7686786No2006-08-032026-08-03Us
US6899699No2002-01-022022-01-02Us
US9108002No2006-01-202026-01-20Us
USRE41956Yes2001-07-212021-07-21Us
US9265893No2012-09-232032-09-23Us
US6004297Yes1999-07-282019-07-28Us
USRE43834No1999-01-282019-01-28Us
US6458924No1997-08-222017-08-22Us
US6268343No2002-08-222022-08-22Us
US8846618No2002-06-272022-06-27Us
US8114833No2005-08-132025-08-13Us
US7235627No1997-08-222017-08-22Us
US7615532No2005-05-252025-05-25Us
US9486588No2002-01-022022-01-02Us
US9457154No2007-09-272027-09-27Us
USRE46363No2006-08-032026-08-03Us
US8937042No2009-05-052029-05-05Us

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Transmembrane signaling receptor activity
Specific Function
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name
GLP1R
Uniprot ID
P43220
Uniprot Name
Glucagon-like peptide 1 receptor
Molecular Weight
53025.22 Da
References
  1. Bock T, Pakkenberg B, Buschard K: The endocrine pancreas in non-diabetic rats after short-term and long-term treatment with the long-acting GLP-1 derivative NN2211. APMIS. 2003 Dec;111(12):1117-24. [PubMed:14678021]
  2. Larsen PJ, Wulff EM, Gotfredsen CF, Brand CL, Sturis J, Vrang N, Knudsen LB, Lykkegaard K: Combination of the insulin sensitizer, pioglitazone, and the long-acting GLP-1 human analog, liraglutide, exerts potent synergistic glucose-lowering efficacy in severely diabetic ZDF rats. Diabetes Obes Metab. 2008 Apr;10(4):301-11. doi: 10.1111/j.1463-1326.2008.00865.x. [PubMed:18333889]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Substrate
General Function
Virus receptor activity
Specific Function
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by bindi...
Gene Name
DPP4
Uniprot ID
P27487
Uniprot Name
Dipeptidyl peptidase 4
Molecular Weight
88277.935 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Substrate
General Function
Zinc ion binding
Specific Function
Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids (PubMed:15283675, PubMed:8168535). Biologically important in the destruction of opioid peptide...
Gene Name
MME
Uniprot ID
P08473
Uniprot Name
Neprilysin
Molecular Weight
85513.225 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]

Drug created on March 19, 2008 10:45 / Updated on October 21, 2017 09:35