You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameLiraglutide
Accession NumberDB06655
TypeBiotech
GroupsApproved
DescriptionVictoza contains liraglutide, an analog of human GLP-1 and acts as a GLP-1 receptor agonist. The peptide precursor of liraglutide, produced by a process that includes expression of recombinant DNA in Saccharomyces cerevisiae, has been engineered to be 97% homologous to native human GLP-1 by substituting arginine for lysine at position 34. Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor.
Protein structureNo structure small
Related Articles
Protein chemical formulaC172H265N43O51
Protein average weight3751.2 Da
Sequences
>results for sequence "results for sequence "victoza"" starting "HisAlaGluGly"
HAEGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
Download FASTA Format
Synonyms
Arg34Lys26-(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-1[7-37]
Liraglutida
Liraglutide recombinant
Liraglutidum
N²⁶-(hexadecanoyl-gamma-glutamyle)-[34-arginine]GLP-1-(7-37)-peptide
N²⁶-(N-Hexadecanoyl-L-gamma-glutamyl)-[34-L-arginine]glucagon-like peptide 1-(7-37)-peptide
NN 2211
NN-2211
NN2211
NNC 90-1170
Victoza
External IDs NN 2211 / UNII-839I73S42A
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SaxendaSolution6 mgSubcutaneousNovo Nordisk2015-05-27Not applicableCanada
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mLSubcutaneousNovo Nordisk2014-12-31Not applicableUs
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection6 mg/mLSubcutaneousNovo Nordisk2010-01-25Not applicableUs
VictozaInjection6 mg/mLSubcutaneousA S Medication Solutions2010-01-25Not applicableUs
VictozaSolution6 mgSubcutaneousNovo Nordisk2010-05-27Not applicableCanada
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixtures
NameLabellerIngredients
XultophyNovo Nordisk
Xultophy Pre-filled PenNovo Nordisk
Xultophy 100/3.6Novo Nordisk
Categories
UNII839I73S42A
CAS number204656-20-2
Pharmacology
IndicationFor use in/treatment of diabetes mellitus type 2.
Structured Indications
PharmacodynamicsLiraglutide is a once-daily GLP-1 derivative for the treatment of type 2 diabetes. GLP-1, in its natural form, is short-lived in the body (the half-life after subcutaneous injection is approximately one hour), so it is not very useful as a therapeutic agent. However, liraglutide has a half-life after subcutaneous injection of 11–15 hours, making it suitable for once-daily dosing. The prolonged action of liraglutide is achieved by attaching a fatty acid molecule at one position of the GLP-1 molecule, enabling it to bind to albumin within the subcutaneous tissue and bloodstream. The active GLP-1 is then released from albumin at a slow, consistent rate. Binding with albumin also results in slower degradation and reduced elimination of liraglutide from the circulation by the kidneys compared to GLP-1.
Mechanism of actionLiraglutide is an acylated GLP-1 (Glucagon-Like Peptide-1) receptor agonist. Liraglutide upregulates intracellular cAMP resulting in the release of insulin given elevated blood glucose concentrations. Glucagon secretion is also decreased in a glucose-dependent fashion by liraglutide.
TargetKindPharmacological actionActionsOrganismUniProt ID
Glucagon-like peptide 1 receptorProteinyes
agonist
HumanP43220 details
Related Articles
AbsorptionMaximum concentrations of liraglutide are achieved at 8-12 hours after dose. The mean peak and total exposures of liraglutide were 35 ng/mL and 960 ng·h/mL, respectively, for a subQ single dose of 0.6 mg. After subcutaneous single dose administrations, Cmax and AUC of liraglutide increased proportionally over the therapeutic dose range of 0.6 mg to 1.8 mg. At 1.8 mg Victoza, the average steady state concentration of liraglutide over 24 hours was approximately 128 ng/mL. AUC0-∞ was equivalent between upper arm and abdomen, and between upper arm and thigh. AUC0-∞ from thigh was 22% lower than that from abdomen. Absolute bioavailability of liraglutide following subcutaneous administration is approximately 55%.
Volume of distribution

SubQ 0.6 mg is approximately 13L
Intravenous is approximately 0.07L/kg

Protein binding>98%
Metabolism

During the initial 24 hours following administration of a single [3H]-liraglutide dose to healthy subjects, the major component in plasma was intact liraglutide. Liraglutide is endogenously metabolized in a similar manner to large proteins without a specific organ as a major route of elimination.

Route of eliminationExcreted in urine and feces, 6% and 5%, respectively.
Half lifeapproximately 13 hours.
Clearance

The mean apparent clearance following subcutaneous administration of a single dose of liraglutide is approximately 1.2 L/h

ToxicityIn a clinical trial, one patient with type 2 diabetes experienced a single overdose of Victoza 17.4 mg subcutaneous (10 times the maximum recommended dose). Effects of the overdose included severe nausea and vomiting requiring hospitalization. No hypoglycemia was reported. The patient recovered without complications. In the event of overdosage, appropriate supportive treatment should be initiated according to the patient’s clinical signs and symptoms. RISK OF THYROID C-CELL TUMORS
Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Liraglutide.Experimental
AcetohexamideLiraglutide may increase the hypoglycemic activities of Acetohexamide.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Liraglutide.Approved
AripiprazoleThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Atazanavir.Approved, Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
BendroflumethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Liraglutide.Withdrawn
BetamethasoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrexpiprazoleThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Brexpiprazole.Approved
BumetanideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Buserelin.Approved
CaroxazoneCaroxazone may increase the hypoglycemic activities of Liraglutide.Withdrawn
CeritinibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorpropamideLiraglutide may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Chlorthalidone.Approved
CinoxacinCinoxacin may increase the hypoglycemic activities of Liraglutide.Approved, Withdrawn
CiprofloxacinCiprofloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
CitalopramCitalopram may increase the hypoglycemic activities of Liraglutide.Approved
ClozapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Cortisone acetate.Approved
Cyproterone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Liraglutide.Investigational
DarunavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Darunavir.Approved
DesogestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Liraglutide.Approved
DexamethasoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DiazoxideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Diazoxide.Approved
DienogestThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Liraglutide.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Liraglutide.Illicit
DisopyramideLiraglutide may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Drospirenone.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Liraglutide.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Liraglutide.Approved
EpinephrineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
EstradiolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ethinyl Estradiol.Approved
Ethynodiol diacetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Liraglutide.Approved
EverolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Everolimus.Approved
FleroxacinFleroxacin may increase the hypoglycemic activities of Liraglutide.Approved
FludrocortisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Liraglutide.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Liraglutide.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
FurosemideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Furosemide.Approved, Vet Approved
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
GlibornurideLiraglutide may increase the hypoglycemic activities of Glibornuride.Withdrawn
GliclazideLiraglutide may increase the hypoglycemic activities of Gliclazide.Approved
GlimepirideLiraglutide may increase the hypoglycemic activities of Glimepiride.Approved
GlipizideLiraglutide may increase the hypoglycemic activities of Glipizide.Approved
GliquidoneLiraglutide may increase the hypoglycemic activities of Gliquidone.Approved
GlisoxepideLiraglutide may increase the hypoglycemic activities of Glisoxepide.Approved
GlyburideLiraglutide may increase the hypoglycemic activities of Glyburide.Approved
GoserelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Liraglutide.Withdrawn
HistrelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Histrelin.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Liraglutide.Approved
HydrochlorothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydroflumethiazide.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
IloperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Liraglutide.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Indinavir.Approved
Insulin AspartLiraglutide may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirLiraglutide may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineLiraglutide may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisineLiraglutide may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanLiraglutide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
Insulin LisproLiraglutide may increase the hypoglycemic activities of Insulin Lispro.Approved
Insulin PorkLiraglutide may increase the hypoglycemic activities of Insulin Pork.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Liraglutide.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Liraglutide.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Liraglutide.Approved
LanreotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Liraglutide.Approved
LevonorgestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Levonorgestrel.Approved, Investigational
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Liraglutide.Approved, Nutraceutical
LomefloxacinLomefloxacin may increase the hypoglycemic activities of Liraglutide.Approved
LopinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
MecaserminLiraglutide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Liraglutide.Approved
MestranolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Mestranol.Approved
MethotrimeprazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methyclothiazide.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Liraglutide.Investigational
MethylprednisoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Liraglutide.Approved
MetolazoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Metolazone.Approved
MifepristoneLiraglutide may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MilnacipranMilnacipran may increase the hypoglycemic activities of Liraglutide.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Liraglutide.Approved
MoclobemideMoclobemide may increase the hypoglycemic activities of Liraglutide.Approved
MoxifloxacinMoxifloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Liraglutide.Approved
NateglinideLiraglutide may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NCX 4016NCX 4016 may increase the hypoglycemic activities of Liraglutide.Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Liraglutide.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Nelfinavir.Approved
NiacinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Liraglutide.Withdrawn
NilotinibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Nilotinib.Approved, Investigational
NorethisteroneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Liraglutide.Approved
NorgestimateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Liraglutide.Withdrawn
OctreotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Octreotide.Approved, Investigational
OfloxacinOfloxacin may increase the hypoglycemic activities of Liraglutide.Approved
OlanzapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Liraglutide.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Liraglutide.Approved, Illicit
PaliperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Paliperidone.Approved
PargylinePargyline may increase the hypoglycemic activities of Liraglutide.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
PasireotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pasireotide.Approved
PefloxacinPefloxacin may increase the hypoglycemic activities of Liraglutide.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Liraglutide.Approved
PentamidineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pentamidine.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Liraglutide.Approved
PheniprazinePheniprazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
PiperazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pipotiazine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Liraglutide.Approved
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
PolythiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Polythiazide.Approved
PrednisoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProgesteroneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Progesterone.Approved, Vet Approved
QuetiapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Quinethazone.Approved
QuinineLiraglutide may increase the hypoglycemic activities of Quinine.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Liraglutide.Approved
RepaglinideLiraglutide may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RisperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ritonavir.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Liraglutide.Approved
SafrazineSafrazine may increase the hypoglycemic activities of Liraglutide.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Saquinavir.Approved, Investigational
SelegilineSelegiline may increase the hypoglycemic activities of Liraglutide.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Liraglutide.Approved
SirolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Sirolimus.Approved, Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Liraglutide.Approved
StanozololStanozolol may increase the hypoglycemic activities of Liraglutide.Approved, Vet Approved
SulfadiazineLiraglutide may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazoleLiraglutide may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazoleLiraglutide may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SunitinibLiraglutide may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Liraglutide.Withdrawn
TemsirolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Liraglutide.Approved, Investigational
TipranavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamideLiraglutide may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamideLiraglutide may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Liraglutide.Approved
TorasemideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Liraglutide.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Liraglutide.Approved
TriamcinoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TriptorelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Liraglutide.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Liraglutide.Approved
VorinostatThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Liraglutide.Withdrawn
ZiprasidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ziprasidone.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Russell-Jones D: Molecular, pharmacological and clinical aspects of liraglutide, a once-daily human GLP-1 analogue. Mol Cell Endocrinol. 2009 Jan 15;297(1-2):137-40. doi: 10.1016/j.mce.2008.11.018. Epub 2008 Nov 25. [PubMed:19041364 ]
  2. Vilsboll T: Liraglutide: a new treatment for type 2 diabetes. Drugs Today (Barc). 2009 Feb;45(2):101-13. doi: 10.1358/dot.2009.45.2.1336104. [PubMed:19343230 ]
  3. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939 ]
  4. Link [Link]
External Links
ATC CodesA10BX07A10AE56
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelDownload (273 KB)
MSDSDownload (569 KB)
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentType 1 Diabetes Mellitus (T1DM)1
1Active Not RecruitingTreatmentDiabetes Mellitus (DM)1
1CompletedBasic ScienceHealthy Volunteers1
1CompletedBasic ScienceType 2 Diabetes Mellitus (T2D)1
1CompletedTreatmentBMI >30 kg/m2 / Healthy Volunteers1
1CompletedTreatmentBMI >30 kg/m2 / Healthy Volunteers / Metabolism and Nutrition Disorder1
1CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder3
1CompletedTreatmentDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent1
1CompletedTreatmentDiabetes / Diabetes Mellitus, Type 11
1CompletedTreatmentDiabetes / Healthy Volunteers14
1CompletedTreatmentDiabetes / Healthy Volunteers / Type 2 Diabetes Mellitus (T2D)1
1CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)15
1CompletedTreatmentType 2 Diabetes Mellitus (T2D)1
1Not Yet RecruitingBasic ScienceType 2 Diabetes Mellitus (T2D)2
1RecruitingTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder2
1Unknown StatusTreatmentDiabetes Mellitus (DM)1
1Unknown StatusTreatmentType 1 Diabetes Mellitus (T1DM)1
1, 2CompletedTreatmentApnea, Sleep / Sleep Disordered Breathing (SDB)1
1, 2RecruitingTreatmentDiabetes, Autoimmune / Type1 Diabetes Mellitus1
2Active Not RecruitingBasic ScienceBMI >30 kg/m21
2Active Not RecruitingTreatmentBMI >30 kg/m22
2Active Not RecruitingTreatmentImpaired Glucose Tolerance Associated With Drugs1
2Active Not RecruitingTreatmentType 2 Diabetes Mellitus (T2D)1
2CompletedNot AvailableChronic Stable Angina / Coronary Heart Disease (CHD) / Ischaemic Heart Diseases1
2CompletedNot AvailableDiabetes / Type 2 Diabetes Mellitus (T2D)1
2CompletedBasic ScienceType 1 Diabetes Mellitus (T1DM)1
2CompletedTreatmentAcute Heart Failure (AHF)1
2CompletedTreatmentBMI >30 kg/m21
2CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
2CompletedTreatmentCongestive Heart Failure (CHF) / Type 2 Diabetes Mellitus (T2D)1
2CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)9
2CompletedTreatmentNonalcoholic Fatty Liver Disease / Nonalcoholic Steatohepatitis / Type 2 Diabetes Mellitus (T2D)1
2CompletedTreatmentNonalcoholic Steatohepatitis1
2CompletedTreatmentType 1 Diabetes Mellitus (T1DM)1
2CompletedTreatmentType 2 Diabetes Mellitus (T2D)5
2Enrolling by InvitationPreventionType 1 Diabetes Mellitus (T1DM)2
2Enrolling by InvitationTreatmentType 1 Diabetes Mellitus (T1DM)1
2RecruitingTreatmentAlzheimer's Disease (AD)1
2RecruitingTreatmentDiabetes / Diabetes Mellitus, Type 11
2RecruitingTreatmentImpaired Glucose Tolerance (IGT) / Psoriasis / Psoriatic Arthritis / Type 2 Diabetes Mellitus (T2D)1
2RecruitingTreatmentParkinson's Disease (PD)1
2RecruitingTreatmentType 1 Diabetes Mellitus (T1DM)1
2RecruitingTreatmentType 2 Diabetes Mellitus (T2D)1
2TerminatedTreatmentDiabetes / Diabetes Mellitus, Type 11
2TerminatedTreatmentType 2 Diabetes Mellitus (T2D)1
2WithdrawnTreatmentKidney Failure,Chronic / Prediabetic State1
2, 3CompletedTreatmentDiabetes Mellitus (DM)1
2, 3CompletedTreatmentMaturity-Onset Diabetes of the Young1
2, 3CompletedTreatmentType 1 Diabetes Mellitus (T1DM)1
2, 3Enrolling by InvitationTreatmentType 1 Diabetes Mellitus (T1DM)1
2, 3Unknown StatusTreatmentDiabetes Mellitus, Type 11
3Active Not RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)2
3CompletedBasic ScienceType 2 Diabetes Mellitus (T2D)1
3CompletedPreventionOlder Adults / Pre-Diabetes1
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder3
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder / Obstructive Sleep Apnoea (OSA)1
3CompletedTreatmentBipolar Disorder (BD) / Major Depressive Disorder (MDD)1
3CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus (T2D)1
3CompletedTreatmentDiabetes / Diabetes Mellitus, Type 13
3CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)20
3CompletedTreatmentDiabetic Kidney Disease1
3CompletedTreatmentType 1 Diabetes Mellitus (T1DM)2
3CompletedTreatmentType 2 Diabetes Mellitus (T2D)5
3Not Yet RecruitingOtherBMI >30 kg/m21
3Not Yet RecruitingTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus (T2D)1
3RecruitingNot AvailableType 1 Diabetes Mellitus (T1DM)1
3RecruitingPreventionDisorder of Glucose Regulation / Gestational Diabetes Mellitus (GDM) / Impaired Glucose Tolerance (IGT) / Metabolic Syndromes / Type 2 Diabetes Mellitus (T2D)1
3RecruitingTreatmentBMI >30 kg/m21
3RecruitingTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder3
3RecruitingTreatmentCardiovascular Diseases / Type 2 Diabetes Mellitus (T2D)1
3RecruitingTreatmentComparative Effectiveness of Glycemia-lowering Medications / Type 2 Diabetes Mellitus (T2D)1
3RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)4
3RecruitingTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Non-Alcoholic Steatohepatitis (NASH) / Weight Loss1
3RecruitingTreatmentPreDiabetes / Type 2 Diabetes Mellitus (T2D)1
3RecruitingTreatmentType 1 Diabetes Mellitus (T1DM)3
3RecruitingTreatmentType 2 Diabetes Mellitus (T2D)2
3TerminatedTreatmentBMI >30 kg/m21
3TerminatedTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)1
3TerminatedTreatmentType 2 Diabetes Mellitus (T2D)1
3Unknown StatusPreventionGlucocorticoid Induced Hyperglycemia1
3WithdrawnTreatmentType 1 Diabetes Mellitus (T1DM)1
4Active Not RecruitingNot AvailableType 2 Diabetes Mellitus (T2D)1
4Active Not RecruitingBasic ScienceInsulin Resistance1
4Active Not RecruitingPreventionGestational Diabetes Mellitus (GDM)1
4Active Not RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Masked Hypertension / Type 2 Diabetes Mellitus (T2D)1
4Active Not RecruitingTreatmentBMI >30 kg/m2 / Diabesity / Type 2 Diabetes Mellitus (T2D)1
4CompletedBasic ScienceDiabetes / Effects of Liraglutide Administration on Brain Activity / Hunger / Weight Loss1
4CompletedBasic ScienceHealthy Human Male Subjects1
4CompletedBasic ScienceSystolic Hypertension / Type 2 Diabetes Mellitus (T2D)1
4CompletedTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Type 2 Diabetes Mellitus (T2D)1
4CompletedTreatmentBMI >27 kg/m2 / Diabetes Mellitus, Type 11
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovarian Syndrome5
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovaries Syndrome1
4CompletedTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus (T2D)1
4CompletedTreatmentCardiovascular Diseases / Diastolic Dysfunction / Fatty Liver / Metabolic Syndromes / Type 2 Diabetes Mellitus (T2D)1
4CompletedTreatmentCardiovascular Diseases / Polycystic Ovaries Syndrome1
4CompletedTreatmentCoronary Artery Disease / Type 2 Diabetes Mellitus (T2D)1
4CompletedTreatmentDIABETES Mellitus Type 2 Not Well Controlled1
4CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent / Hypertensive Disease1
4CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)4
4CompletedTreatmentDiabetic Kidney Disease1
4CompletedTreatmentEnd-Stage Renal Disease (ESRD) / Type 2 Diabetes Mellitus (T2D)1
4CompletedTreatmentHealthy Volunteers1
4CompletedTreatmentMicrovascular Dysfunction / Type 2 Diabetes Mellitus (T2D)1
4CompletedTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Type2 Diabetes1
4CompletedTreatmentType 2 Diabetes Mellitus (T2D)8
4Enrolling by InvitationTreatmentBMI >30 kg/m2 / General Surgery / Hypoglycemia1
4Not Yet RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Monoclonal Gammopathies1
4Not Yet RecruitingTreatmentBMI >30 kg/m2 / Diabetes Mellitus (DM) / Weight Loss1
4RecruitingNot AvailableBMI >27 kg/m2 / Type 2 Diabetes Mellitus (T2D)1
4RecruitingNot AvailableBariatric Surgery Candidate / Obesity, Morbid1
4RecruitingBasic ScienceDiabetes Mellitus, Adult-Onset / Inflammatory processes / Type 2 Diabetes Mellitus (T2D)1
4RecruitingOtherBMI >30 kg/m21
4RecruitingPreventionCardiovascular Diseases / Fat Disorder / Obesity, Visceral1
4RecruitingPreventionPre-Diabetes1
4RecruitingSupportive CareAcromegaly / Cushing's Disease1
4RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Human Immunodeficiency Virus (HIV) Infections / Metabolic Syndromes / Type 2 Diabetes Mellitus (T2D)1
4RecruitingTreatmentBMI >30 kg/m21
4RecruitingTreatmentBMI >30 kg/m2 / Synovitis of osteoarthritis4
4RecruitingTreatmentCardiac MRI / Diastolic Dysfunction / Myocardial Perfusion / Type 2 Diabetes Mellitus (T2D)1
4RecruitingTreatmentCardiovascular Diseases / Diastolic Dysfunction / Fatty Liver / Metabolic Syndromes / Type 2 Diabetes Mellitus (T2D)1
4RecruitingTreatmentDiabetes Complications / Osteoporosis1
4RecruitingTreatmentDiabetes Mellitus (DM)1
4RecruitingTreatmentDiabetes, Autoimmune / Type 1 Diabetes Mellitus (T1DM)1
4RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus (T2D)2
4RecruitingTreatmentGLP-1;Telomere-telomerase System; Par-4 / GLP-1;Metformin;Telomere-telomerase System;Par-41
4RecruitingTreatmentMicrovascular Angina1
4RecruitingTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD)1
4RecruitingTreatmentOsteoarthritis,Knee1
4RecruitingTreatmentType 2 Diabetes Mellitus (T2D)6
4RecruitingTreatmentType 2 Diabetes Patients1
4RecruitingTreatmentType II Diabetes in Subjects BMI 27 to 32 / Type II Diabetes in the Not so Obese1
4TerminatedTreatmentPrader Willi Syndrome / Type 2 Diabetes Mellitus (T2D)1
4TerminatedTreatmentType 2 Diabetes Mellitus (T2D)2
4Unknown StatusBasic ScienceType 2 Diabetes Mellitus (T2D)1
4Unknown StatusTreatmentBinge Eating Behaviour1
4Unknown StatusTreatmentGastric Banding / Type 2 Diabetes Mellitus (T2D)1
4Unknown StatusTreatmentType 1 Diabetes Mellitus (T1DM)1
4Unknown StatusTreatmentType 2 Diabetes Mellitus (T2D)1
4Unknown StatusTreatmentUncontrolled Type 1 Diabetic Patients1
4WithdrawnNot AvailableType 2 Diabetes Mellitus (T2D)1
Not AvailableCompletedNot AvailableBMI >30 kg/m2 / Type 2 Diabetes Mellitus (T2D)1
Not AvailableCompletedNot AvailableDiabetes / Type 2 Diabetes Mellitus (T2D)10
Not AvailableCompletedNot AvailableDiabetic Nephropathies / Type 2 Diabetes Mellitus (T2D)1
Not AvailableCompletedNot AvailableType 1 Diabetes Mellitus (T1DM)1
Not AvailableCompletedNot AvailableType 2 Diabetes Mellitus (T2D)4
Not AvailableCompletedBasic ScienceType 2 Diabetes Mellitus (T2D)1
Not AvailableCompletedDiagnosticBMI >30 kg/m2 / Type 2 Diabetes Mellitus (T2D)1
Not AvailableCompletedHealth Services ResearchBMI >27 kg/m2 / Type 2 Diabetes Mellitus (T2D)1
Not AvailableCompletedTreatmentAlzheimers Disease1
Not AvailableCompletedTreatmentChronic Heart Failure (CHF) / Hyperglycemias1
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentType 2 Diabetes Mellitus (T2D)1
Not AvailableEnrolling by InvitationNot AvailableBMI >30 kg/m21
Not AvailableEnrolling by InvitationNot AvailableDiabetes / Type 2 Diabetes Mellitus (T2D)1
Not AvailableEnrolling by InvitationTreatmentDiabetes Mellitus, Type 1 / Type 1 Diabetes Mellitus (T1DM)1
Not AvailableEnrolling by InvitationTreatmentIschemic Cardiomyopathy1
Not AvailableNot Yet RecruitingNot AvailableType 2 Diabetes Mellitus (T2D)1
Not AvailableNot Yet RecruitingTreatmentBMI >30 kg/m21
Not AvailableNot Yet RecruitingTreatmentType 2 Diabetes Mellitus (T2D)1
Not AvailableRecruitingNot AvailableDementias / Insulin Resistance1
Not AvailableRecruitingNot AvailableType 2 Diabetes Mellitus (T2D)1
Not AvailableRecruitingBasic ScienceBMI >30 kg/m21
Not AvailableRecruitingTreatmentAcute Myocardial Infarction (AMI)1
Not AvailableRecruitingTreatmentAcute ST-segment Elevation Myocardial Infarction1
Not AvailableRecruitingTreatmentCoronary Artery Disease / Diabetes Mellitus (DM) / Type 2 Diabetes Mellitus (T2D)1
Not AvailableRecruitingTreatmentHeart Failure (HF)2
Not AvailableRecruitingTreatmentMyocardial Infarction (MI)1
Not AvailableRecruitingTreatmentType 2 Diabetes Mellitus (T2D)1
Not AvailableUnknown StatusNot AvailableReduction of Psoriasis Following Liraglutide Therapy in Terms of PASI and DLQI1
Not AvailableUnknown StatusBasic ScienceDiabetes1
Not AvailableUnknown StatusPreventionIncretinomimetics / Pancreas / Type 2 Diabetes Mellitus (T2D)1
Not AvailableUnknown StatusTreatmentType 2 Diabetes Mellitus (T2D)1
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous6 mg/ml
InjectionSubcutaneous6 mg/mL
SolutionSubcutaneous6 mg
Injection, solutionSubcutaneous
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2264243 No2004-10-052017-08-22Canada
US6004297 No1999-01-282019-01-28Us
US6268343 No2002-08-222022-08-22Us
US6458924 No1997-08-222017-08-22Us
US6899699 No2002-01-012022-01-01Us
US7235627 No1997-08-222017-08-22Us
US7686786 No2006-08-032026-08-03Us
US8114833 No2005-08-132025-08-13Us
US8672898 No2002-01-022022-01-02Us
US8684969 No2005-10-202025-10-20Us
US8846618 No2002-06-272022-06-27Us
US8920383 No2006-07-172026-07-17Us
US9108002 No2006-01-262026-01-26Us
US9132239 No2012-02-012032-02-01Us
US9265893 No2012-09-232032-09-23Us
USRE41956 No2001-01-212021-01-21Us
USRE43834 No1999-01-282019-01-28Us
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Transmembrane signaling receptor activity
Specific Function:
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name:
GLP1R
Uniprot ID:
P43220
Molecular Weight:
53025.22 Da
References
  1. Bock T, Pakkenberg B, Buschard K: The endocrine pancreas in non-diabetic rats after short-term and long-term treatment with the long-acting GLP-1 derivative NN2211. APMIS. 2003 Dec;111(12):1117-24. [PubMed:14678021 ]
  2. Larsen PJ, Wulff EM, Gotfredsen CF, Brand CL, Sturis J, Vrang N, Knudsen LB, Lykkegaard K: Combination of the insulin sensitizer, pioglitazone, and the long-acting GLP-1 human analog, liraglutide, exerts potent synergistic glucose-lowering efficacy in severely diabetic ZDF rats. Diabetes Obes Metab. 2008 Apr;10(4):301-11. doi: 10.1111/j.1463-1326.2008.00865.x. [PubMed:18333889 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
substrate
General Function:
Virus receptor activity
Specific Function:
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also ...
Gene Name:
DPP4
Uniprot ID:
P27487
Molecular Weight:
88277.935 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
substrate
General Function:
Zinc ion binding
Specific Function:
Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids (PubMed:15283675, PubMed:8168535). Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond (PubMed:17101991). Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9 (PubMed:15283675). Involved in the degradation of at...
Gene Name:
MME
Uniprot ID:
P08473
Molecular Weight:
85513.225 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939 ]
Comments
comments powered by Disqus
Drug created on March 19, 2008 10:45 / Updated on April 29, 2017 05:15