Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
Liraglutide
Accession Number
DB06655
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones
Description

Victoza contains liraglutide, a synthetic analog of human glucagon-like peptide-1(GLP-1) and acts as a GLP-1 receptor agonistLabel,1. Liraglutide is 97% homologous to native human GLP-1 by substituting arginine for lysine at position 341. Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor1. Liraglutide was granted FDA approval on Januray 25, 20104.

Protein chemical formula
C172H265N43O51
Protein average weight
3751.2 Da
Sequences
>Liraglutide Sequence (gamma-E-palmitoyl at E21)
HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG
Download FASTA Format
Synonyms
  • Arg34Lys26-(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-1[7-37]
  • Liraglutida
  • Liraglutide (genetical recombination)
  • Liraglutide (rDNA origin)
  • Liraglutide recombinant
  • Liraglutidum
  • N²⁶-(hexadecanoyl-gamma-glutamyle)-[34-arginine]GLP-1-(7-37)-peptide
  • N²⁶-(N-Hexadecanoyl-L-gamma-glutamyl)-[34-L-arginine]glucagon-like peptide 1-(7-37)-peptide
External IDs
NN 2211 / NN-2211 / NN-9924 / NN2211 / NN9924 / NNC 90-1170 / NNC-90-1170
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2015-03-23Not applicableEu
SaxendaInjection, solution6 mg/1mLSubcutaneousNovo Nordisk2014-12-31Not applicableUs
SaxendaSolution6 mgSubcutaneousNovo Nordisk2015-05-27Not applicableCanada
VictozaSolution6 mgSubcutaneousNovo Nordisk2010-05-27Not applicableCanada
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection6 mg/1mLSubcutaneousA-S Medication Solutions2010-01-25Not applicableUs
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
VictozaInjection, solution6 mg/mlSubcutaneousNovo Nordisk2009-06-30Not applicableEu
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
XultophyLiraglutide (3.6 mg) + Insulin Degludec (100 unit)SolutionSubcutaneousNovo Nordisk2018-06-06Not applicableCanada
XultophyLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
Xultophy 100/3.6Liraglutide (3.6 mg/1mL) + Insulin Degludec (100 [iU]/1mL)Injection, solutionSubcutaneousNovo Nordisk2016-11-21Not applicableUs
Xultophy Pre-filled PenLiraglutide (3.6 mg/ml) + Insulin Degludec (100 U/ml)Injection, solutionSubcutaneousNovo Nordisk2014-09-18Not applicableEu
Categories
UNII
839I73S42A
CAS number
204656-20-2

Pharmacology

Indication

Liraglutide is indicated in combination with diet and exercise to improve glycemic control in patients 10 years and older with type 2 diabetes mellitusLabel,5. It is also indicated to reduce the risk of major adverse cardiovascular events in patients with type 2 diabetes mellitus as well as cardiovascular diseaseLabel.

Associated Conditions
Pharmacodynamics

Liraglutide is a once-daily GLP-1 derivative for the treatment of type 2 diabetesLabel,2. The prolonged action of liraglutide is achieved by attaching a fatty acid molecule at position 26 of the GLP-1 molecule, enabling it to bind reversibly to albumin within the subcutaneous tissue and bloodstream and be released slowly over timeLabel,2,3. Binding with albumin results in slower degradation and reduced elimination of liraglutide from the circulation by the kidneys compared to GLP-12,3. The effect of liraglutide is the increased secretion of insulin and decreased secretion of glucagon in response to glucose as well as slower gastric emptyingLabel. Liraglutide also does not adversely affect glucagon secretion in response to low blood sugarLabel,2.

Mechanism of action

Liraglutide is an acylated synthetic glucagon-like peptide-1 analogLabel,1,2. Liraglutide is an agonist of the glucagon-like peptide-1 receptor which is coupled to adenylate cyclaseLabel. The increase in cyclic AMP stimulates the glucose dependant release of insulin, inhibits the glucose dependant release of glucagon, and slows gastric emptying to increase control of blood sugarLabel,3.

TargetActionsOrganism
AGlucagon-like peptide 1 receptor
agonist
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Bioavailability of liraglutide after subcutaneous injection is approximately 55%Label and maximum concentrations are reached after 11.7 hours1.

Volume of distribution

13LLabel.

Protein binding

>98%Label.

Metabolism

Liraglutide is less sensitive to metabolism than the endogenous GLP-1 and so is more slowly metabolized by dipeptidyl peptidase-4 and neutral endopeptidase to various smaller polypeptides which have not all been structurally determined1. A portion of Liraglutide may be completely metabolized to carbon dioxide and water1.

Route of elimination

6% excreted in urine and 5% excreted in feces1.

Half life

Terminal half life of 13 hours1.

Clearance

1.2L/hLabel.

Toxicity

There is no clinical significance of race or ethnicity on the safety or efficacy of liraglutideLabel. Geriatric patients do not experience clinically significant differences in pharmacokinetics though patients at an especially advanced age may be more susceptible to adverse effectsLabel. Female patients have reduced clearance of liraglutide but no dose adjustment is necessaryLabel. The risk and benefit of liraglutide in pregnancy must be weighed before prescribingLabel. In animal studies, liraglutide is associated with an increased risk of embryonic death and fetal abnormalities though an HbA1c > 7 is also associated with a 20-25% risk of birth defectsLabel. In animal studies, liraglutide is present in the milk of lactating rats at half the plasma concentration of the mother but these results may not translate to humansLabel. Because it is not known if liraglutide is present in breast milk and the effects on infants are also unknown, the risk and benefit of liraglutide in breastfeeding must be considered before prescribingLabel. Liraglutide was shown to be safe and effective in patients up to 160kg in weight but has not been studied in patients at a higher weightLabel. A patient's weight significantly affects the pharmacokinetics of liraglutideLabel. Liraglutide has not been investigated for use in pediatric patientsLabel. No dosage adjustments are necessary in patients with renal impairment but studies have not been performed in patients with end stage renal diseaseLabel. There are no recommendations on dosage adjustment in patients with hepatic impairment, though caution should still be exercised when prescribing to this populationLabel.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
2,4-thiazolidinedioneThe risk or severity of hypoglycemia can be increased when Liraglutide is combined with 2,4-thiazolidinedione.
5-(2-methylpiperazine-1-sulfonyl)isoquinolineThe therapeutic efficacy of Liraglutide can be increased when used in combination with 5-(2-methylpiperazine-1-sulfonyl)isoquinoline.
7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline may increase the hypoglycemic activities of Liraglutide.
AcarboseThe risk or severity of hypoglycemia can be increased when Acarbose is combined with Liraglutide.
AcebutololThe therapeutic efficacy of Liraglutide can be increased when used in combination with Acebutolol.
AcetazolamideThe therapeutic efficacy of Liraglutide can be increased when used in combination with Acetazolamide.
AcetohexamideLiraglutide may increase the hypoglycemic activities of Acetohexamide.
Acetyl sulfisoxazoleThe therapeutic efficacy of Liraglutide can be increased when used in combination with Acetyl sulfisoxazole.
Acetylsalicylic acidThe risk or severity of hypoglycemia can be increased when Acetylsalicylic acid is combined with Liraglutide.
AgmatineThe risk or severity of hypoglycemia can be increased when Agmatine is combined with Liraglutide.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]
  2. Knudsen B, Jesper Lau: The Discovery and Development of Liraglutide and Semaglutide Frontiers in Endocrinology.
  3. Russell-Jones D: Molecular, pharmacological and clinical aspects of liraglutide, a once-daily human GLP-1 analogue. Mol Cell Endocrinol. 2009 Jan 15;297(1-2):137-40. doi: 10.1016/j.mce.2008.11.018. Epub 2008 Nov 25. [PubMed:19041364]
  4. FDA Drug Approval Package: Liraglutide [Link]
  5. FDA News Release: Liraglutide Indication [Link]
External Links
UniProt
P01275
KEGG Drug
D06404
PubChem Substance
347910356
ChEBI
71193
ChEMBL
CHEMBL1201866
PharmGKB
PA165958364
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Liraglutide
ATC Codes
A10AE56 — Insulin degludec and liraglutideA10BJ02 — Liraglutide
AHFS Codes
  • 68:20.06 — Incretin Mimetics
FDA label
Download (1.32 MB)
MSDS
Download (569 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
0RecruitingBasic ScienceType 1 Insulin-Dependent Diabetes Mellitus1
1Active Not RecruitingOtherBMI >30 kg/m21
1CompletedBasic ScienceBMI >30 kg/m21
1CompletedBasic ScienceHealthy Volunteers1
1CompletedBasic ScienceType 2 Diabetes Mellitus2
1CompletedOtherDementias / Insulin Resistance1
1CompletedTreatmentBMI >30 kg/m2 / Healthy Volunteers / Metabolism and Nutrition Disorder2
1CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder5
1CompletedTreatmentDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus (DM) / Healthy Volunteers15
1CompletedTreatmentDiabetes Mellitus (DM) / Healthy Volunteers / Type 2 Diabetes Mellitus5
1CompletedTreatmentDiabetes Mellitus (DM) / Type 1 Insulin-Dependent Diabetes Mellitus1
1CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus16
1CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent1
1CompletedTreatmentType 2 Diabetes Mellitus1
1RecruitingBasic ScienceType 2 Diabetes Mellitus1
1TerminatedTreatmentDiabetes Mellitus (DM)1
1Unknown StatusTreatmentDiabetes Mellitus (DM)1
1WithdrawnTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
1, 2CompletedTreatmentSleep Apnea Syndrome / Sleep Disordered Breathing (SDB)1
1, 2RecruitingTreatmentDiabetes, Autoimmune / Type1 Diabetes Mellitus1
1, 2RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2Active Not RecruitingBasic ScienceBMI >30 kg/m21
2Active Not RecruitingTreatmentAlzheimer's Disease (AD)1
2Active Not RecruitingTreatmentImpaired Glucose Tolerance Associated With Drugs1
2CompletedNot AvailableChronic Stable Angina Pectoris / Coronary Heart Disease (CHD) / Ischaemic Heart Diseases1
2CompletedNot AvailableDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
2CompletedBasic ScienceType 1 Insulin-Dependent Diabetes Mellitus1
2CompletedTreatmentAcute Heart Failure (AHF)1
2CompletedTreatmentBMI >30 kg/m23
2CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder2
2CompletedTreatmentCongestive Heart Failure / Type 2 Diabetes Mellitus1
2CompletedTreatmentDiabetes Mellitus (DM) / Type 1 Insulin-Dependent Diabetes Mellitus1
2CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus9
2CompletedTreatmentNonalcoholic Fatty Liver Disease / Nonalcoholic Steatohepatitis / Type 2 Diabetes Mellitus1
2CompletedTreatmentNonalcoholic Steatohepatitis1
2CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus2
2CompletedTreatmentType 2 Diabetes Mellitus7
2Enrolling by InvitationPreventionType 1 Insulin-Dependent Diabetes Mellitus2
2Enrolling by InvitationTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2Not Yet RecruitingTreatmentShort Bowel Syndrome (SBS)1
2RecruitingPreventionAutonomic Nervous System Diseases / Diabetic Neuropathy With Neurologic Complication / Sweat Gland Diseases1
2RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m21
2RecruitingTreatmentBMI >30 kg/m21
2RecruitingTreatmentBipolar Disorder (BD) / BMI >30 kg/m21
2RecruitingTreatmentCessation, Smoking / Weight, Body1
2RecruitingTreatmentImpaired Glucose Tolerance (IGT) / Psoriasis / Psoriatic Arthritis / Type 2 Diabetes Mellitus1
2RecruitingTreatmentNeural Development / Obesity, Childhood1
2RecruitingTreatmentParkinson's Disease (PD)1
2RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2RecruitingTreatmentType 2 Diabetes Mellitus1
2TerminatedTreatmentDiabetes Mellitus (DM) / Type 1 Insulin-Dependent Diabetes Mellitus1
2TerminatedTreatmentType 2 Diabetes Mellitus2
2WithdrawnTreatmentChronic Renal Failure (CRF) / Prediabetic State1
2, 3Active Not RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2, 3CompletedTreatmentDiabetes Mellitus (DM)1
2, 3CompletedTreatmentMaturity-Onset Diabetes of the Young1
2, 3CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2, 3Enrolling by InvitationTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
3Active Not RecruitingTreatmentComparative Effectiveness of Glycemia-lowering Medications / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentPre-Diabetic / Type 2 Diabetes Mellitus1
3CompletedBasic ScienceType 2 Diabetes Mellitus1
3CompletedPreventionDisorder of Glucose Regulation / Gestational Diabetes Mellitus (GDM) / Impaired Glucose Tolerance (IGT) / Metabolic Syndromes / Type 2 Diabetes Mellitus1
3CompletedPreventionOlder Adults / Pre-Diabetic1
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder6
3CompletedTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder / Obstructive Sleep Apnoea (OSA)1
3CompletedTreatmentBipolar Disorder (BD) / Major Depressive Disorder (MDD)1
3CompletedTreatmentCardiovascular Disease (CVD) / Type 2 Diabetes Mellitus1
3CompletedTreatmentDiabetes Mellitus (DM) / Type 1 Insulin-Dependent Diabetes Mellitus3
3CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus38
3CompletedTreatmentDiabetic Kidney Disease1
3CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus2
3CompletedTreatmentType 2 Diabetes Mellitus8
3Not Yet RecruitingOtherCardiovascular Disease (CVD) / Type 2 Diabetes Mellitus1
3Not Yet RecruitingTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
3Not Yet RecruitingTreatmentStroke, Ischemic / Transient Ischaemic Attack (TIA) / Type 2 Diabetes Mellitus1
3Not Yet RecruitingTreatmentType 2 Diabetes Mellitus1
3RecruitingOtherBMI >30 kg/m21
3RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m21
3RecruitingTreatmentBMI >30 kg/m23
3RecruitingTreatmentBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
3RecruitingTreatmentBrain Death1
3RecruitingTreatmentDiabetes Mellitus (DM)1
3RecruitingTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Non-Alcoholic Steatohepatitis (NASH) / Obese experiencing rapid weight loss1
3RecruitingTreatmentObesity Android / Polycystic Ovaries Syndrome / Pre Diabetes1
3RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus4
3RecruitingTreatmentType 2 Diabetes Mellitus2
3TerminatedTreatmentBMI >30 kg/m21
3TerminatedTreatmentBinge Eating Disorder (BED)1
3TerminatedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
3TerminatedTreatmentType 2 Diabetes Mellitus1
3Unknown StatusPreventionGlucocorticoid Induced Hyperglycemia1
3WithdrawnTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
4Active Not RecruitingNot AvailableType 2 Diabetes Mellitus1
4Active Not RecruitingBasic ScienceInsulin Resistance1
4Active Not RecruitingOtherBMI >30 kg/m21
4Active Not RecruitingPreventionGestational Diabetes Mellitus (GDM)1
4Active Not RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Masked Hypertension / Type 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentBMI >30 kg/m21
4Active Not RecruitingTreatmentBMI >30 kg/m2 / Diabesity / Type 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentCardiac MRI / Diastolic Dysfunction / Myocardial Perfusion / Type 2 Diabetes Mellitus1
4CompletedBasic ScienceDiabetes Mellitus (DM) / Effects of Liraglutide Administration on Brain Activity / Hunger / Obese experiencing rapid weight loss1
4CompletedBasic ScienceHealthy Human Male Subjects1
4CompletedBasic ScienceSystolic Hypertension / Type 2 Diabetes Mellitus1
4CompletedOtherBariatric Surgery Candidate / Obesity, Morbid1
4CompletedPreventionPre-Diabetic1
4CompletedSupportive CareAcromegaly / Cushing's Disease1
4CompletedTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Type 2 Diabetes Mellitus1
4CompletedTreatmentBMI >27 kg/m2 / Type 1 Insulin-Dependent Diabetes Mellitus1
4CompletedTreatmentBMI >30 kg/m21
4CompletedTreatmentBMI >30 kg/m2 / General Surgery / Hypoglycemia1
4CompletedTreatmentBMI >30 kg/m2 / Hypogonadism1
4CompletedTreatmentBMI >30 kg/m2 / Infertility, Female / Polycystic Ovaries Syndrome1
4CompletedTreatmentBMI >30 kg/m2 / Osteoarthritis (OA)4
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovarian Syndrome5
4CompletedTreatmentBMI >30 kg/m2 / Polycystic Ovaries Syndrome1
4CompletedTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
4CompletedTreatmentBinge Eating Behaviour1
4CompletedTreatmentCardiovascular Disease (CVD) / Diastolic Dysfunction / Fatty Liver / Metabolic Syndromes / Type 2 Diabetes Mellitus2
4CompletedTreatmentCardiovascular Disease (CVD) / Polycystic Ovaries Syndrome1
4CompletedTreatmentCoronary Artery Disease / Type 2 Diabetes Mellitus1
4CompletedTreatmentDIABETES Mellitus Type 2 Not Well Controlled1
4CompletedTreatmentDiabetes Complications / Osteoporosis1
4CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus6
4CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent / Hypertensive Disease1
4CompletedTreatmentDiabetic Kidney Disease1
4CompletedTreatmentEnd-Stage Renal Disease (ESRD) / Type 2 Diabetes Mellitus1
4CompletedTreatmentHealthy Volunteers1
4CompletedTreatmentKnee Osteoarthritis (Knee OA)1
4CompletedTreatmentMicrovascular Dysfunction / Type 2 Diabetes Mellitus1
4CompletedTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD)1
4CompletedTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Type2 Diabetes1
4CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
4CompletedTreatmentType 2 Diabetes Mellitus10
4Not Yet RecruitingPreventionBMI >30 kg/m21
4Not Yet RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Monoclonal Gammopathy1
4Not Yet RecruitingTreatmentBMI >30 kg/m21
4Not Yet RecruitingTreatmentPeripheral Vascular Disorder Due to Diabetes Mellitus / Type 2 Diabetes Mellitus1
4RecruitingBasic ScienceBMI >30 kg/m2 / Pre-Diabetic1
4RecruitingBasic ScienceBile Acid Malabsorption1
4RecruitingBasic ScienceDiabetes Mellitus, Adult-Onset / Inflammatory Reaction / Type 2 Diabetes Mellitus1
4RecruitingPreventionCardiovascular Disease (CVD) / Lipid Metabolism Disorders / Obesity, Visceral1
4RecruitingPreventionType 2 Diabetes Mellitus1
4RecruitingTreatmentAtrial Fibrillation (AF)1
4RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Human Immunodeficiency Virus (HIV) Infections / Metabolic Syndromes / Type 2 Diabetes Mellitus1
4RecruitingTreatmentBMI >27 kg/m2 / BMI >30 kg/m2 / Polycystic Ovary Syndrome (PCOS)1
4RecruitingTreatmentBMI >30 kg/m21
4RecruitingTreatmentBMI >30 kg/m2 / Diabetes Mellitus (DM) / Obese experiencing rapid weight loss1
4RecruitingTreatmentBMI >30 kg/m2 / Metabolic Syndromes / Polycystic Ovarian Syndrome1
4RecruitingTreatmentBMI >30 kg/m2 / Microbiome / Obese experiencing rapid weight loss1
4RecruitingTreatmentChronic Obstructive Pulmonary Disease (COPD)1
4RecruitingTreatmentCoronary Artery Disease / Type2 Diabetes1
4RecruitingTreatmentDiabetes Mellitus (DM)1
4RecruitingTreatmentDiabetes, Autoimmune / Type 1 Insulin-Dependent Diabetes Mellitus1
4RecruitingTreatmentGLP-1;Telomere-telomerase System; Par-4 / GLP-1;Metformin;Telomere-telomerase System;Par-41
4RecruitingTreatmentHyperglycaemia (Diabetic) / Overweight and Obesity / Type 2 Diabetes Patients1
4RecruitingTreatmentMicrovascular Angina1
4RecruitingTreatmentType 2 Diabetes Mellitus4
4RecruitingTreatmentType II Diabetes in Subjects BMI 27 to 32 / Type II Diabetes in the Not so Obese1
4RecruitingTreatmentType2 Diabetes1
4TerminatedNot AvailableBMI >27 kg/m2 / Type 2 Diabetes Mellitus1
4TerminatedTreatmentGastric Banding / Type 2 Diabetes Mellitus1
4TerminatedTreatmentPrader-Willi Syndrome / Type 2 Diabetes Mellitus1
4TerminatedTreatmentType 2 Diabetes Mellitus2
4Unknown StatusTreatmentType 2 Diabetes Mellitus1
4Unknown StatusTreatmentUncontrolled Type 1 Diabetic Patients1
4WithdrawnNot AvailableType 2 Diabetes Mellitus1
4WithdrawnBasic ScienceType 2 Diabetes Mellitus1
Not AvailableActive Not RecruitingNot AvailableDiabetes Mellitus (DM)2
Not AvailableActive Not RecruitingBasic ScienceBMI >30 kg/m21
Not AvailableCompletedNot AvailableBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
Not AvailableCompletedNot AvailableBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus12
Not AvailableCompletedNot AvailableDiabetic Nephropathies / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableType 1 Insulin-Dependent Diabetes Mellitus1
Not AvailableCompletedNot AvailableType 2 Diabetes Mellitus5
Not AvailableCompletedBasic ScienceDiabetes Mellitus (DM)1
Not AvailableCompletedBasic ScienceType 2 Diabetes Mellitus1
Not AvailableCompletedDiagnosticBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedHealth Services ResearchBMI >27 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedOtherType 2 Diabetes Mellitus1
Not AvailableCompletedTreatmentAlzheimers Disease1
Not AvailableCompletedTreatmentBMI >30 kg/m21
Not AvailableCompletedTreatmentChronic Heart Failure (CHF) / Hyperglycemias1
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentPsoriasis / Type 2 Diabetes Mellitus1
Not AvailableCompletedTreatmentType 2 Diabetes Mellitus2
Not AvailableEnrolling by InvitationNot AvailableBMI >27 kg/m2 / BMI >30 kg/m21
Not AvailableEnrolling by InvitationNot AvailableBMI >30 kg/m2 / Metabolism and Nutrition Disorder1
Not AvailableEnrolling by InvitationNot AvailableType 2 Diabetes Mellitus2
Not AvailableEnrolling by InvitationTreatmentIschaemic Cardiomyopathy1
Not AvailableEnrolling by InvitationTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
Not AvailableNot Yet RecruitingNot AvailableDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
Not AvailableNot Yet RecruitingTreatmentDiabetic Neuropathic Pain1
Not AvailableNot Yet RecruitingTreatmentType 2 Diabetes Mellitus1
Not AvailableRecruitingNot AvailableBMI >27 kg/m2 / BMI >30 kg/m2 / Infertility, Female1
Not AvailableRecruitingNot AvailableBMI >27 kg/m2 / BMI >30 kg/m2 / Metabolism and Nutrition Disorder1
Not AvailableRecruitingOtherType 2 Diabetes Mellitus1
Not AvailableRecruitingPreventionIncretinomimetics / Pancreas / Type 2 Diabetes Mellitus1
Not AvailableRecruitingTreatmentAcute Myocardial Infarction (AMI)1
Not AvailableRecruitingTreatmentAcute ST-segment Elevation Myocardial Infarction1
Not AvailableRecruitingTreatmentBMI >30 kg/m21
Not AvailableRecruitingTreatmentCoronary Artery Disease / Diabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
Not AvailableRecruitingTreatmentHeart Failure2
Not AvailableRecruitingTreatmentMyocardial Infarction1
Not AvailableRecruitingTreatmentType 2 Diabetes Mellitus1
Not AvailableUnknown StatusNot AvailableReduction of Psoriasis Following Liraglutide Therapy in Terms of PASI and DLQI1
Not AvailableUnknown StatusTreatmentType 2 Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous6 mg/ml
Injection, solutionSubcutaneous6 mg/1mL
InjectionSubcutaneous6 mg/1mL
SolutionSubcutaneous6 mg
Injection, solutionSubcutaneous
SolutionSubcutaneous
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2264243No2004-10-052017-08-22Canada
US8672898Yes2014-03-182022-07-02Us
US8684969Yes2014-04-012026-04-20Us
US9132239Yes2015-09-152032-08-01Us
US8920383Yes2014-12-302027-01-17Us
US7686786No2010-03-302026-08-03Us
US6899699Yes2005-05-312022-07-01Us
US9108002Yes2015-08-182026-07-26Us
USRE41956Yes2010-11-232021-07-21Us
US9265893Yes2016-02-232033-03-23Us
US6004297Yes1999-12-212019-07-28Us
USRE43834No2012-11-272019-01-28Us
US6458924No2002-10-012017-08-22Us
US6268343Yes2001-07-312023-02-22Us
US8846618Yes2014-09-302022-12-27Us
US8114833Yes2012-02-142026-02-13Us
US7235627No2007-06-262017-08-22Us
US7615532Yes2009-11-102029-12-28Us
US9486588Yes2016-11-082022-07-02Us
US9457154Yes2016-10-042028-03-27Us
USRE46363Yes2017-04-112027-02-03Us
US8937042Yes2015-01-202029-11-05Us
US9687611Yes2017-06-272027-08-27Us
US9775953Yes2017-10-032027-01-17Us
US8579869Yes2013-11-122023-12-30Us
US7762994Yes2010-07-272024-11-23Us
US9968659Yes2018-05-152037-07-09Us
US9861757Yes2018-01-092026-07-20Us
US9616180Yes2017-04-112026-07-20Us
US10220155Yes2019-03-052027-01-17Us
US10357616No2006-01-202026-01-20Us
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Solid
Experimental Properties
PropertyValueSource
isoelectric point4.9https://www.accessdata.fda.gov/drugsatfda_docs/nda/2014/206321Orig1s000ChemR.pdf

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Agonist
General Function
Transmembrane signaling receptor activity
Specific Function
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name
GLP1R
Uniprot ID
P43220
Uniprot Name
Glucagon-like peptide 1 receptor
Molecular Weight
53025.22 Da
References
  1. Bock T, Pakkenberg B, Buschard K: The endocrine pancreas in non-diabetic rats after short-term and long-term treatment with the long-acting GLP-1 derivative NN2211. APMIS. 2003 Dec;111(12):1117-24. [PubMed:14678021]
  2. Larsen PJ, Wulff EM, Gotfredsen CF, Brand CL, Sturis J, Vrang N, Knudsen LB, Lykkegaard K: Combination of the insulin sensitizer, pioglitazone, and the long-acting GLP-1 human analog, liraglutide, exerts potent synergistic glucose-lowering efficacy in severely diabetic ZDF rats. Diabetes Obes Metab. 2008 Apr;10(4):301-11. doi: 10.1111/j.1463-1326.2008.00865.x. [PubMed:18333889]

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Substrate
General Function
Virus receptor activity
Specific Function
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by bindi...
Gene Name
DPP4
Uniprot ID
P27487
Uniprot Name
Dipeptidyl peptidase 4
Molecular Weight
88277.935 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Substrate
General Function
Zinc ion binding
Specific Function
Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids (PubMed:15283675, PubMed:8168535). Biologically important in the destruction of opioid peptide...
Gene Name
MME
Uniprot ID
P08473
Uniprot Name
Neprilysin
Molecular Weight
85513.225 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939]

Carriers

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Binder
General Function
Toxic substance binding
Specific Function
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloid...
Gene Name
ALB
Uniprot ID
P02768
Uniprot Name
Serum albumin
Molecular Weight
69365.94 Da
References
  1. Knudsen B, Jesper Lau: The Discovery and Development of Liraglutide and Semaglutide Frontiers in Endocrinology.

Drug created on March 19, 2008 10:45 / Updated on November 11, 2019 06:56