Siltuximab - DrugBank

ID Pharmacology Interactions References Trials Economics Properties Taxonomy

Targets (1)

Targets (1)Biointeractions (2)

Identification

Name

Siltuximab

Accession Number

DB09036

Type

Biotech

Groups

Approved

Description

Siltuximab is a chimeric (human-mouse) monoclonal immunoglobulin G1-kappa antibody produced in a Chinese hamster ovary (CHO) cell line by recombinant DNA technology. Siltuximab prevents the binding of IL-6 to soluble and membrane-bound IL-6 receptors by forming high affinity complexes with human interleukin-6 (IL-6). Its use is indicated for the treatment of adult patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. MCD is a rare blood disorder caused by dysregulated IL-6 production, proliferation of lymphocytes, and subsequent enlargement of the lymph nodes. It is administered as a 1 hour intravenous infusion every 3 weeks.

Protein structure

Protein chemical formula

C₆₄₅₀H₉₉₃₂N₁₆₈₈O₂₀₁₆S₅₀

Protein average weight

145000.0 Da

Sequences

>Heavy Chain Sequence
EVQLVESGGKLLKPGGSLKLSCAASGFTFSSFAMSWFRQSPEKRLEWVAEISSGGSYTYY
PDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGLWGYYALDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK

>Light Chain Sequence
QIVLIQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATYYCQQWSGYPYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Download FASTA Format

Synonyms

Not Available

External IDs

CLLB8 / CNTO 328 / CNTO-328 / CNTO328

Product Ingredients

Not Available

Approved Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Sylvant	Injection, powder, lyophilized, for solution	100 mg/1	Intravenous	Janssen Biotech, Inc.	2014-04-23	Not applicable	US
Sylvant	Powder, for solution	400 mg	Intravenous	Janssen Pharmaceuticals	2015-03-03	Not applicable	Canada
Sylvant	Injection, powder, lyophilized, for solution	400 mg/1	Intravenous	Janssen Biotech, Inc.	2014-04-01	Not applicable	US
Sylvant	Powder, for solution	100 mg	Intravenous	Janssen Pharmaceuticals	2015-03-03	Not applicable	Canada

Approved Generic Prescription Products

Not Available

Approved Over the Counter Products

Not Available

Unapproved/Other Products

Not Available

International Brands

Not Available

Brand mixtures

Not Available

Categories

UNII

T4H8FMA7IM

CAS number

541502-14-1

Pharmacology

Indication

Siltuximab is indicated for the treatment of patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. Siltuximab did not bind to virally produced IL-6 in a nonclinical study and was therefore not studied in patients with MCD who are HIV or HHV-8 positive.

Structured Indications

Castleman's Disease

Pharmacodynamics

Siltuximab-neutralized antibody-IL-6 complexes interfere with current immunological-based IL-6 quantification methods, therefore measurement of serum or plasma IL-6 concentrations should not be used as a pharmacodynamic marker during treatment. As well, cytochrome P450 enzymes in the liver are down regulated by infection and inflammation stimuli, which includes cytokines such as IL-6. By preventing IL-6 signalling through treatment with siltuximab, CYP450 activity may be increased leading to faster metabolism of drugs that are CYP450 substrates.

Mechanism of action

Siltuximab complexes with human IL-6 and prevents binding to soluble and membrane-bound IL-6 receptors, thereby inhibiting the proliferation of lymphocytes.

Target	Kind	Pharmacological action	Actions	Organism	UniProt ID
Interleukin-6	Protein	yes	antagonist antibody	Human	P05231	details

Absorption

Not Available

Volume of distribution

Based on population pharmacokinetic analysis, the central volume of distribution in a male subject with body weight of 70 kg is 4.5 L.

Protein binding

Not Available

Metabolism

As siltuximab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of elimination

Not Available

Half life

The mean terminal half life after the first intravenous infusion of 11 mg/kg is 20.6 days.

Clearance

Body weight was identified as the only statistically significant covariate of siltuximab clearance, therefore body weight based dosing is appropriate. Based on population pharmacokinetic analysis, the clearance of situximab in patients is 0.23 L/day.

Toxicity

The most common side effects that occurred during siltuximab treatment were pruritis, increased weight, rash, hyperuricemia, and upper respiratory tract infection. Siltuximab should not be administered to patients with severe infections as it may mask signs and symptoms of acute inflammation including suppression of fever and acute phase reactants such as C-reactive protein (CRP). Gastrointestinal perforation has been reported in clinical trials, therefore use with caution in patients who may be at increased risk for GI perforation.

Affected organisms

Not Available

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction	Drug group
Abiraterone	The serum concentration of Abiraterone can be decreased when it is combined with Siltuximab.	Approved
Acenocoumarol	The serum concentration of Acenocoumarol can be decreased when it is combined with Siltuximab.	Approved
Acetaminophen	The serum concentration of Acetaminophen can be decreased when it is combined with Siltuximab.	Approved
Acetyldigitoxin	Acetyldigitoxin may decrease the cardiotoxic activities of Siltuximab.	Approved
Adinazolam	The serum concentration of Adinazolam can be decreased when it is combined with Siltuximab.	Approved
Albendazole	The serum concentration of Albendazole can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Alclometasone	The serum concentration of Alclometasone can be decreased when it is combined with Siltuximab.	Approved
Alfentanil	The serum concentration of Alfentanil can be decreased when it is combined with Siltuximab.	Approved, Illicit
Alfuzosin	The serum concentration of Alfuzosin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Aliskiren	The serum concentration of Aliskiren can be decreased when it is combined with Siltuximab.	Approved, Investigational
Allylestrenol	The serum concentration of Allylestrenol can be decreased when it is combined with Siltuximab.	Approved
Almotriptan	The serum concentration of Almotriptan can be decreased when it is combined with Siltuximab.	Approved, Investigational
Alogliptin	The serum concentration of Alogliptin can be decreased when it is combined with Siltuximab.	Approved
Alosetron	The serum concentration of Alosetron can be decreased when it is combined with Siltuximab.	Approved, Withdrawn
Alprazolam	The serum concentration of Alprazolam can be decreased when it is combined with Siltuximab.	Approved, Illicit, Investigational
Ambrisentan	The serum concentration of Ambrisentan can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ambroxol	The serum concentration of Ambroxol can be decreased when it is combined with Siltuximab.	Approved
Aminophenazone	The serum concentration of Aminophenazone can be decreased when it is combined with Siltuximab.	Approved, Withdrawn
Aminophylline	The serum concentration of Aminophylline can be decreased when it is combined with Siltuximab.	Approved
Amiodarone	The serum concentration of Amiodarone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Amitriptyline	The serum concentration of Amitriptyline can be decreased when it is combined with Siltuximab.	Approved
Amlodipine	The serum concentration of Amlodipine can be decreased when it is combined with Siltuximab.	Approved
Amprenavir	The serum concentration of Amprenavir can be decreased when it is combined with Siltuximab.	Approved
Antipyrine	The serum concentration of Antipyrine can be decreased when it is combined with Siltuximab.	Approved
Apixaban	The serum concentration of Apixaban can be decreased when it is combined with Siltuximab.	Approved
Apremilast	The serum concentration of Apremilast can be decreased when it is combined with Siltuximab.	Approved, Investigational
Aprepitant	The serum concentration of Aprepitant can be decreased when it is combined with Siltuximab.	Approved, Investigational
Argatroban	The serum concentration of Argatroban can be decreased when it is combined with Siltuximab.	Approved, Investigational
Aripiprazole	The serum concentration of Aripiprazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Artemether	The serum concentration of Artemether can be decreased when it is combined with Siltuximab.	Approved
Asenapine	The serum concentration of Asenapine can be decreased when it is combined with Siltuximab.	Approved
Astemizole	The serum concentration of Astemizole can be decreased when it is combined with Siltuximab.	Approved, Withdrawn
Atazanavir	The serum concentration of Atazanavir can be decreased when it is combined with Siltuximab.	Approved, Investigational
Atorvastatin	The serum concentration of Atorvastatin can be decreased when it is combined with Siltuximab.	Approved
Avanafil	The serum concentration of Avanafil can be decreased when it is combined with Siltuximab.	Approved
Axitinib	The serum concentration of Axitinib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Azelastine	The serum concentration of Azelastine can be decreased when it is combined with Siltuximab.	Approved
Azithromycin	The serum concentration of Azithromycin can be decreased when it is combined with Siltuximab.	Approved
Banoxantrone	The serum concentration of Banoxantrone can be decreased when it is combined with Siltuximab.	Investigational
BCG vaccine	The therapeutic efficacy of Bcg can be decreased when used in combination with Siltuximab.	Investigational
Bedaquiline	The serum concentration of Bedaquiline can be decreased when it is combined with Siltuximab.	Approved
Benzphetamine	The serum concentration of Benzphetamine can be decreased when it is combined with Siltuximab.	Approved, Illicit
Benzyl alcohol	The serum concentration of Benzyl alcohol can be decreased when it is combined with Siltuximab.	Approved
Bevacizumab	Bevacizumab may increase the cardiotoxic activities of Siltuximab.	Approved, Investigational
Bexarotene	The serum concentration of Bexarotene can be decreased when it is combined with Siltuximab.	Approved, Investigational
Bezafibrate	The serum concentration of Bezafibrate can be decreased when it is combined with Siltuximab.	Approved
Bicalutamide	The serum concentration of Bicalutamide can be decreased when it is combined with Siltuximab.	Approved
Bisoprolol	The serum concentration of Bisoprolol can be decreased when it is combined with Siltuximab.	Approved
Boceprevir	The serum concentration of Boceprevir can be decreased when it is combined with Siltuximab.	Approved, Investigational
Bortezomib	The serum concentration of Bortezomib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Bosentan	The serum concentration of Bosentan can be decreased when it is combined with Siltuximab.	Approved, Investigational
Bosutinib	The serum concentration of Bosutinib can be decreased when it is combined with Siltuximab.	Approved
Brentuximab vedotin	The serum concentration of Brentuximab vedotin can be decreased when it is combined with Siltuximab.	Approved
Brexpiprazole	The serum concentration of Brexpiprazole can be decreased when it is combined with Siltuximab.	Approved
Brinzolamide	The serum concentration of Brinzolamide can be decreased when it is combined with Siltuximab.	Approved
Bromazepam	The serum concentration of Bromazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Bromocriptine	The serum concentration of Bromocriptine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Brompheniramine	The serum concentration of Brompheniramine can be decreased when it is combined with Siltuximab.	Approved
Budesonide	The serum concentration of Budesonide can be decreased when it is combined with Siltuximab.	Approved
Bupivacaine	The serum concentration of Bupivacaine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Buprenorphine	The serum concentration of Buprenorphine can be decreased when it is combined with Siltuximab.	Approved, Illicit, Investigational, Vet Approved
Bupropion	The serum concentration of Bupropion can be decreased when it is combined with Siltuximab.	Approved
Buspirone	The serum concentration of Buspirone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Busulfan	The serum concentration of Busulfan can be decreased when it is combined with Siltuximab.	Approved, Investigational
Cabazitaxel	The serum concentration of Cabazitaxel can be decreased when it is combined with Siltuximab.	Approved
Cabergoline	The serum concentration of Cabergoline can be decreased when it is combined with Siltuximab.	Approved
Cabozantinib	The serum concentration of Cabozantinib can be decreased when it is combined with Siltuximab.	Approved
Caffeine	The serum concentration of Caffeine can be decreased when it is combined with Siltuximab.	Approved
Calcitriol	The serum concentration of Calcitriol can be decreased when it is combined with Siltuximab.	Approved, Nutraceutical
Canagliflozin	The serum concentration of Canagliflozin can be decreased when it is combined with Siltuximab.	Approved
Carbamazepine	The serum concentration of Carbamazepine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Carbinoxamine	The serum concentration of Carbinoxamine can be decreased when it is combined with Siltuximab.	Approved
Cariprazine	The serum concentration of Cariprazine can be decreased when it is combined with Siltuximab.	Approved
Carvedilol	The serum concentration of Carvedilol can be decreased when it is combined with Siltuximab.	Approved, Investigational
Celecoxib	The serum concentration of Celecoxib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Celiprolol	The serum concentration of Celiprolol can be decreased when it is combined with Siltuximab.	Approved, Investigational
Cephalexin	The serum concentration of Cephalexin can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Cerivastatin	The serum concentration of Cerivastatin can be decreased when it is combined with Siltuximab.	Withdrawn
Cevimeline	The serum concentration of Cevimeline can be decreased when it is combined with Siltuximab.	Approved
Chenodeoxycholic acid	The serum concentration of Chenodeoxycholic acid can be decreased when it is combined with Siltuximab.	Approved
Chlordiazepoxide	The serum concentration of Chlordiazepoxide can be decreased when it is combined with Siltuximab.	Approved, Illicit
Chloroquine	The serum concentration of Chloroquine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Chlorphenamine	The serum concentration of Chlorphenamine can be decreased when it is combined with Siltuximab.	Approved
Chlorpromazine	The serum concentration of Chlorpromazine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Chlorzoxazone	The serum concentration of Chlorzoxazone can be decreased when it is combined with Siltuximab.	Approved
Cholecalciferol	The serum concentration of Cholecalciferol can be decreased when it is combined with Siltuximab.	Approved, Nutraceutical
Ciclesonide	The serum concentration of Ciclesonide can be decreased when it is combined with Siltuximab.	Approved, Investigational
Cilostazol	The serum concentration of Cilostazol can be decreased when it is combined with Siltuximab.	Approved
Cinacalcet	The serum concentration of Cinacalcet can be decreased when it is combined with Siltuximab.	Approved
Cisapride	The serum concentration of Cisapride can be decreased when it is combined with Siltuximab.	Approved, Investigational, Withdrawn
Citalopram	The serum concentration of Citalopram can be decreased when it is combined with Siltuximab.	Approved
Clarithromycin	The serum concentration of Clarithromycin can be decreased when it is combined with Siltuximab.	Approved
Clindamycin	The serum concentration of Clindamycin can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Clobazam	The serum concentration of Clobazam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Clofazimine	The serum concentration of Clofazimine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Clofibrate	The serum concentration of Clofibrate can be decreased when it is combined with Siltuximab.	Approved
Clomipramine	The serum concentration of Clomipramine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Clonazepam	The serum concentration of Clonazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Clonidine	The serum concentration of Clonidine can be decreased when it is combined with Siltuximab.	Approved
Clopidogrel	The serum concentration of Clopidogrel can be decreased when it is combined with Siltuximab.	Approved, Nutraceutical
Clorazepate	The serum concentration of Clorazepate can be decreased when it is combined with Siltuximab.	Approved, Illicit
Clotiazepam	The serum concentration of Clotiazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Clozapine	The serum concentration of Clozapine can be decreased when it is combined with Siltuximab.	Approved
Cocaine	The serum concentration of Cocaine can be decreased when it is combined with Siltuximab.	Approved, Illicit
Codeine	The serum concentration of Codeine can be decreased when it is combined with Siltuximab.	Approved, Illicit
Colchicine	The serum concentration of Colchicine can be decreased when it is combined with Siltuximab.	Approved
Conivaptan	The serum concentration of Conivaptan can be decreased when it is combined with Siltuximab.	Approved, Investigational
Conjugated estrogens	The serum concentration of Conjugated Equine Estrogens can be decreased when it is combined with Siltuximab.	Approved
Cortisone acetate	The serum concentration of Cortisone acetate can be decreased when it is combined with Siltuximab.	Approved
Crizotinib	The serum concentration of Crizotinib can be decreased when it is combined with Siltuximab.	Approved
Cyclobenzaprine	The serum concentration of Cyclobenzaprine can be decreased when it is combined with Siltuximab.	Approved
Cyclophosphamide	The serum concentration of Cyclophosphamide can be decreased when it is combined with Siltuximab.	Approved, Investigational
Cyclosporine	The serum concentration of Cyclosporine can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Cytarabine	The serum concentration of Cytarabine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Dabrafenib	The serum concentration of Dabrafenib can be decreased when it is combined with Siltuximab.	Approved
Daclatasvir	The serum concentration of Daclatasvir can be decreased when it is combined with Siltuximab.	Approved
Dantrolene	The serum concentration of Dantrolene can be decreased when it is combined with Siltuximab.	Approved
Dapagliflozin	The serum concentration of Dapagliflozin can be decreased when it is combined with Siltuximab.	Approved
Dapsone	The serum concentration of Dapsone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Darifenacin	The serum concentration of Darifenacin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Darunavir	The serum concentration of Darunavir can be decreased when it is combined with Siltuximab.	Approved
Dasabuvir	The serum concentration of Dasabuvir can be decreased when it is combined with Siltuximab.	Approved
Dasatinib	The serum concentration of Dasatinib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Daunorubicin	The serum concentration of Daunorubicin can be decreased when it is combined with Siltuximab.	Approved
Delavirdine	The serum concentration of Delavirdine can be decreased when it is combined with Siltuximab.	Approved
Denosumab	The risk or severity of adverse effects can be increased when Denosumab is combined with Siltuximab.	Approved
Deslanoside	Deslanoside may decrease the cardiotoxic activities of Siltuximab.	Approved
Desvenlafaxine	The serum concentration of Desvenlafaxine can be decreased when it is combined with Siltuximab.	Approved
Dexamethasone	The serum concentration of Dexamethasone can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Dextromethorphan	The serum concentration of Dextromethorphan can be decreased when it is combined with Siltuximab.	Approved
Dextropropoxyphene	The serum concentration of Dextropropoxyphene can be decreased when it is combined with Siltuximab.	Approved, Illicit, Withdrawn
Diazepam	The serum concentration of Diazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit, Vet Approved
Diclofenac	The serum concentration of Diclofenac can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Digitoxin	The serum concentration of Digitoxin can be decreased when it is combined with Siltuximab.	Approved
Digoxin	The serum concentration of Digoxin can be decreased when it is combined with Siltuximab.	Approved
Dihydrocodeine	The serum concentration of Dihydrocodeine can be decreased when it is combined with Siltuximab.	Approved, Illicit
Dihydroergotamine	The serum concentration of Dihydroergotamine can be decreased when it is combined with Siltuximab.	Approved
Diltiazem	The serum concentration of Diltiazem can be decreased when it is combined with Siltuximab.	Approved
Disopyramide	The serum concentration of Disopyramide can be decreased when it is combined with Siltuximab.	Approved
Disulfiram	The serum concentration of Disulfiram can be decreased when it is combined with Siltuximab.	Approved
Docetaxel	The serum concentration of Docetaxel can be decreased when it is combined with Siltuximab.	Approved, Investigational
Dofetilide	The serum concentration of Dofetilide can be decreased when it is combined with Siltuximab.	Approved
Dolasetron	The serum concentration of Dolasetron can be decreased when it is combined with Siltuximab.	Approved
Domperidone	The serum concentration of Domperidone can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Donepezil	The serum concentration of Donepezil can be decreased when it is combined with Siltuximab.	Approved
Dorzolamide	The serum concentration of Dorzolamide can be decreased when it is combined with Siltuximab.	Approved
Doxepin	The serum concentration of Doxepin can be decreased when it is combined with Siltuximab.	Approved
Doxorubicin	The serum concentration of Doxorubicin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Dronabinol	The serum concentration of Dronabinol can be decreased when it is combined with Siltuximab.	Approved, Illicit
Dronedarone	The serum concentration of Dronedarone can be decreased when it is combined with Siltuximab.	Approved
Dutasteride	The serum concentration of Dutasteride can be decreased when it is combined with Siltuximab.	Approved, Investigational
Efavirenz	The serum concentration of Efavirenz can be decreased when it is combined with Siltuximab.	Approved, Investigational
Eletriptan	The serum concentration of Eletriptan can be decreased when it is combined with Siltuximab.	Approved, Investigational
Eliglustat	The serum concentration of Eliglustat can be decreased when it is combined with Siltuximab.	Approved
Elvitegravir	The serum concentration of Elvitegravir can be decreased when it is combined with Siltuximab.	Approved
Enalapril	The serum concentration of Enalapril can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Enzalutamide	The serum concentration of Enzalutamide can be decreased when it is combined with Siltuximab.	Approved
Epinastine	The serum concentration of Epinastine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Eplerenone	The serum concentration of Eplerenone can be decreased when it is combined with Siltuximab.	Approved
Ergocalciferol	The serum concentration of Ergocalciferol can be decreased when it is combined with Siltuximab.	Approved, Nutraceutical
Ergoloid mesylate	The serum concentration of Ergoloid mesylate can be decreased when it is combined with Siltuximab.	Approved
Ergonovine	The serum concentration of Ergonovine can be decreased when it is combined with Siltuximab.	Approved
Ergotamine	The serum concentration of Ergotamine can be decreased when it is combined with Siltuximab.	Approved
Erlotinib	The serum concentration of Erlotinib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Erythromycin	The serum concentration of Erythromycin can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Escitalopram	The serum concentration of Escitalopram can be decreased when it is combined with Siltuximab.	Approved, Investigational
Esomeprazole	The serum concentration of Esomeprazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Estazolam	The serum concentration of Estazolam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Estradiol	The serum concentration of Estradiol can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Estramustine	The serum concentration of Estramustine can be decreased when it is combined with Siltuximab.	Approved
Estrone	The serum concentration of Estrone can be decreased when it is combined with Siltuximab.	Approved
Estrone sulfate	The serum concentration of Estrone sulfate can be decreased when it is combined with Siltuximab.	Approved
Eszopiclone	The serum concentration of Eszopiclone can be decreased when it is combined with Siltuximab.	Approved
Ethanol	The serum concentration of Ethanol can be decreased when it is combined with Siltuximab.	Approved
Ethinyl Estradiol	The serum concentration of Ethinyl Estradiol can be decreased when it is combined with Siltuximab.	Approved
Ethosuximide	The serum concentration of Ethosuximide can be decreased when it is combined with Siltuximab.	Approved
Ethylmorphine	The serum concentration of Ethylmorphine can be decreased when it is combined with Siltuximab.	Approved, Illicit
Etonogestrel	The serum concentration of Etonogestrel can be decreased when it is combined with Siltuximab.	Approved, Investigational
Etoposide	The serum concentration of Etoposide can be decreased when it is combined with Siltuximab.	Approved
Etoricoxib	The serum concentration of Etoricoxib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Etravirine	The serum concentration of Etravirine can be decreased when it is combined with Siltuximab.	Approved
Everolimus	The serum concentration of Everolimus can be decreased when it is combined with Siltuximab.	Approved
Exemestane	The serum concentration of Exemestane can be decreased when it is combined with Siltuximab.	Approved, Investigational
Famciclovir	The serum concentration of Famciclovir can be decreased when it is combined with Siltuximab.	Approved
Felbamate	The serum concentration of Felbamate can be decreased when it is combined with Siltuximab.	Approved
Felodipine	The serum concentration of Felodipine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Fenofibrate	The serum concentration of Fenofibrate can be decreased when it is combined with Siltuximab.	Approved
Fentanyl	The serum concentration of Fentanyl can be decreased when it is combined with Siltuximab.	Approved, Illicit, Investigational, Vet Approved
Fesoterodine	The serum concentration of Fesoterodine can be decreased when it is combined with Siltuximab.	Approved
Finasteride	The serum concentration of Finasteride can be decreased when it is combined with Siltuximab.	Approved
Fingolimod	Siltuximab may increase the immunosuppressive activities of Fingolimod.	Approved, Investigational
Flibanserin	The serum concentration of Flibanserin can be decreased when it is combined with Siltuximab.	Approved
Flunisolide	The serum concentration of Flunisolide can be decreased when it is combined with Siltuximab.	Approved, Investigational
Flunitrazepam	The serum concentration of Flunitrazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Fluorometholone	The serum concentration of Fluorometholone can be decreased when it is combined with Siltuximab.	Approved
Fluoxetine	The serum concentration of Fluoxetine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Flurazepam	The serum concentration of Flurazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Flutamide	The serum concentration of Flutamide can be decreased when it is combined with Siltuximab.	Approved
Fluticasone furoate	The serum concentration of Fluticasone furoate can be decreased when it is combined with Siltuximab.	Approved
Fluticasone propionate	The serum concentration of Fluticasone Propionate can be decreased when it is combined with Siltuximab.	Approved
Fluvastatin	The serum concentration of Fluvastatin can be decreased when it is combined with Siltuximab.	Approved
Fosamprenavir	The serum concentration of Fosamprenavir can be decreased when it is combined with Siltuximab.	Approved
Fulvestrant	The serum concentration of Fulvestrant can be decreased when it is combined with Siltuximab.	Approved, Investigational
G17DT	The risk or severity of adverse effects can be increased when Siltuximab is combined with G17DT.	Investigational
Galantamine	The serum concentration of Galantamine can be decreased when it is combined with Siltuximab.	Approved
Gefitinib	The serum concentration of Gefitinib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Gemfibrozil	The serum concentration of Gemfibrozil can be decreased when it is combined with Siltuximab.	Approved
Glipizide	The serum concentration of Glipizide can be decreased when it is combined with Siltuximab.	Approved
Glyburide	The serum concentration of Glyburide can be decreased when it is combined with Siltuximab.	Approved
Granisetron	The serum concentration of Granisetron can be decreased when it is combined with Siltuximab.	Approved, Investigational
Grepafloxacin	The serum concentration of Grepafloxacin can be decreased when it is combined with Siltuximab.	Withdrawn
Guanfacine	The serum concentration of Guanfacine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Halofantrine	The serum concentration of Halofantrine can be decreased when it is combined with Siltuximab.	Approved
Haloperidol	The serum concentration of Haloperidol can be decreased when it is combined with Siltuximab.	Approved
Halothane	The serum concentration of Halothane can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Hexobarbital	The serum concentration of Hexobarbital can be decreased when it is combined with Siltuximab.	Approved
Histamine	The serum concentration of Histamine Phosphate can be decreased when it is combined with Siltuximab.	Approved, Investigational
Hydrocodone	The serum concentration of Hydrocodone can be decreased when it is combined with Siltuximab.	Approved, Illicit
Hydrocortisone	The serum concentration of Hydrocortisone can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Hydromorphone	The serum concentration of Hydromorphone can be decreased when it is combined with Siltuximab.	Approved, Illicit
Hydroxyprogesterone caproate	The serum concentration of Hydroxyprogesterone caproate can be decreased when it is combined with Siltuximab.	Approved
Ibrutinib	The serum concentration of Ibrutinib can be decreased when it is combined with Siltuximab.	Approved
Ifosfamide	The serum concentration of Ifosfamide can be decreased when it is combined with Siltuximab.	Approved
Iloperidone	The serum concentration of Iloperidone can be decreased when it is combined with Siltuximab.	Approved
Imatinib	The serum concentration of Imatinib can be decreased when it is combined with Siltuximab.	Approved
Imipramine	The serum concentration of Imipramine can be decreased when it is combined with Siltuximab.	Approved
Imiquimod	The serum concentration of Imiquimod can be decreased when it is combined with Siltuximab.	Approved, Investigational
Indacaterol	The serum concentration of Indacaterol can be decreased when it is combined with Siltuximab.	Approved
Indapamide	The serum concentration of Indapamide can be decreased when it is combined with Siltuximab.	Approved
Indinavir	The serum concentration of Indinavir can be decreased when it is combined with Siltuximab.	Approved
INGN 201	The risk or severity of adverse effects can be increased when Siltuximab is combined with INGN 201.	Investigational
INGN 225	The risk or severity of adverse effects can be increased when Siltuximab is combined with INGN 225.	Investigational
Ipratropium bromide	The serum concentration of Ipratropium bromide can be decreased when it is combined with Siltuximab.	Approved
Irinotecan	The serum concentration of Irinotecan can be decreased when it is combined with Siltuximab.	Approved, Investigational
Isavuconazonium	The serum concentration of Isavuconazonium can be decreased when it is combined with Siltuximab.	Approved, Investigational
Isosorbide Dinitrate	The serum concentration of Isosorbide Dinitrate can be decreased when it is combined with Siltuximab.	Approved
Isosorbide Mononitrate	The serum concentration of Isosorbide Mononitrate can be decreased when it is combined with Siltuximab.	Approved
Isradipine	The serum concentration of Isradipine can be decreased when it is combined with Siltuximab.	Approved
Itraconazole	The serum concentration of Itraconazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ivabradine	The serum concentration of Ivabradine can be decreased when it is combined with Siltuximab.	Approved
Ivacaftor	The serum concentration of Ivacaftor can be decreased when it is combined with Siltuximab.	Approved
Ivermectin	The serum concentration of Ivermectin can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Ixabepilone	The serum concentration of Ixabepilone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ixazomib	The serum concentration of Ixazomib can be decreased when it is combined with Siltuximab.	Approved
Ketamine	The serum concentration of Ketamine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Ketazolam	The serum concentration of Ketazolam can be decreased when it is combined with Siltuximab.	Approved
Ketobemidone	The serum concentration of Ketobemidone can be decreased when it is combined with Siltuximab.	Approved
Ketoconazole	The serum concentration of Ketoconazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Lansoprazole	The serum concentration of Lansoprazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Lapatinib	The serum concentration of Lapatinib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Laquinimod	The serum concentration of Laquinimod can be decreased when it is combined with Siltuximab.	Investigational
Leflunomide	The risk or severity of adverse effects can be increased when Siltuximab is combined with Leflunomide.	Approved, Investigational
Lenvatinib	The serum concentration of Lenvatinib can be decreased when it is combined with Siltuximab.	Approved
Lercanidipine	The serum concentration of Lercanidipine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Letrozole	The serum concentration of Letrozole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Levobupivacaine	The serum concentration of Levobupivacaine can be decreased when it is combined with Siltuximab.	Approved
Levocetirizine	The serum concentration of Levocetirizine can be decreased when it is combined with Siltuximab.	Approved
Levomethadyl Acetate	The serum concentration of Levomethadyl Acetate can be decreased when it is combined with Siltuximab.	Approved
Levomilnacipran	The serum concentration of Levomilnacipran can be decreased when it is combined with Siltuximab.	Approved
Levonorgestrel	The serum concentration of Levonorgestrel can be decreased when it is combined with Siltuximab.	Approved, Investigational
Levothyroxine	The serum concentration of Levothyroxine can be decreased when it is combined with Siltuximab.	Approved
Lidocaine	The serum concentration of Lidocaine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Lisuride	The serum concentration of Lisuride can be decreased when it is combined with Siltuximab.	Approved
Lomitapide	The serum concentration of Lomitapide can be decreased when it is combined with Siltuximab.	Approved
Loperamide	The serum concentration of Loperamide can be decreased when it is combined with Siltuximab.	Approved
Lopinavir	The serum concentration of Lopinavir can be decreased when it is combined with Siltuximab.	Approved
Loratadine	The serum concentration of Loratadine can be decreased when it is combined with Siltuximab.	Approved
Lorcaserin	The serum concentration of Lorcaserin can be decreased when it is combined with Siltuximab.	Approved
Losartan	The serum concentration of Losartan can be decreased when it is combined with Siltuximab.	Approved
Lovastatin	The serum concentration of Lovastatin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Lumefantrine	The serum concentration of Lumefantrine can be decreased when it is combined with Siltuximab.	Approved
Lurasidone	The serum concentration of Lurasidone can be decreased when it is combined with Siltuximab.	Approved
Macitentan	The serum concentration of Macitentan can be decreased when it is combined with Siltuximab.	Approved
Maraviroc	The serum concentration of Maraviroc can be decreased when it is combined with Siltuximab.	Approved, Investigational
Mebendazole	The serum concentration of Mebendazole can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Medroxyprogesterone acetate	The serum concentration of Medroxyprogesterone acetate can be decreased when it is combined with Siltuximab.	Approved, Investigational
Mefloquine	The serum concentration of Mefloquine can be decreased when it is combined with Siltuximab.	Approved
Meloxicam	The serum concentration of Meloxicam can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Methadone	The serum concentration of Methadone can be decreased when it is combined with Siltuximab.	Approved
Methaqualone	The serum concentration of Methaqualone can be decreased when it is combined with Siltuximab.	Illicit, Withdrawn
Methoxsalen	The serum concentration of Methoxsalen can be decreased when it is combined with Siltuximab.	Approved
Methoxyflurane	The serum concentration of Methoxyflurane can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Methylprednisolone	The serum concentration of Methylprednisolone can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Methyltestosterone	The serum concentration of Methyltestosterone can be decreased when it is combined with Siltuximab.	Approved
Metronidazole	The serum concentration of Metronidazole can be decreased when it is combined with Siltuximab.	Approved
Mexiletine	The serum concentration of Mexiletine can be decreased when it is combined with Siltuximab.	Approved
Mianserin	The serum concentration of Mianserin can be decreased when it is combined with Siltuximab.	Approved
Mibefradil	The serum concentration of Mibefradil can be decreased when it is combined with Siltuximab.	Withdrawn
Miconazole	The serum concentration of Miconazole can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Midazolam	The serum concentration of Midazolam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Mifepristone	The serum concentration of Mifepristone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Mirabegron	The serum concentration of Mirabegron can be decreased when it is combined with Siltuximab.	Approved
Mirtazapine	The serum concentration of Mirtazapine can be decreased when it is combined with Siltuximab.	Approved
Modafinil	The serum concentration of Modafinil can be decreased when it is combined with Siltuximab.	Approved, Investigational
Montelukast	The serum concentration of Montelukast can be decreased when it is combined with Siltuximab.	Approved
Morphine	The serum concentration of Morphine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Mycophenolate mofetil	The serum concentration of Mycophenolate mofetil can be decreased when it is combined with Siltuximab.	Approved, Investigational
Naloxegol	The serum concentration of Naloxegol can be decreased when it is combined with Siltuximab.	Approved
Naloxone	The serum concentration of Naloxone can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Natalizumab	The risk or severity of adverse effects can be increased when Siltuximab is combined with Natalizumab.	Approved, Investigational
Nateglinide	The serum concentration of Nateglinide can be decreased when it is combined with Siltuximab.	Approved, Investigational
Nefazodone	The serum concentration of Nefazodone can be decreased when it is combined with Siltuximab.	Approved, Withdrawn
Nelfinavir	The serum concentration of Nelfinavir can be decreased when it is combined with Siltuximab.	Approved
Nevirapine	The serum concentration of Nevirapine can be decreased when it is combined with Siltuximab.	Approved
Nicardipine	The serum concentration of Nicardipine can be decreased when it is combined with Siltuximab.	Approved
Nicotine	The serum concentration of Nicotine can be decreased when it is combined with Siltuximab.	Approved
Nifedipine	The serum concentration of Nifedipine can be decreased when it is combined with Siltuximab.	Approved
Nilotinib	The serum concentration of Nilotinib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Nilvadipine	The serum concentration of Nilvadipine can be decreased when it is combined with Siltuximab.	Approved
Nimodipine	The serum concentration of Nimodipine can be decreased when it is combined with Siltuximab.	Approved
Nisoldipine	The serum concentration of Nisoldipine can be decreased when it is combined with Siltuximab.	Approved
Nitrazepam	The serum concentration of Nitrazepam can be decreased when it is combined with Siltuximab.	Approved
Nitrendipine	The serum concentration of Nitrendipine can be decreased when it is combined with Siltuximab.	Approved
Norethisterone	The serum concentration of Norethisterone can be decreased when it is combined with Siltuximab.	Approved
Norgestrel	The serum concentration of Norgestrel can be decreased when it is combined with Siltuximab.	Approved
Nortriptyline	The serum concentration of Nortriptyline can be decreased when it is combined with Siltuximab.	Approved
Olaparib	The serum concentration of Olaparib can be decreased when it is combined with Siltuximab.	Approved
Oleandrin	Anvirzel may decrease the cardiotoxic activities of Siltuximab.	Experimental
Olopatadine	The serum concentration of Olopatadine can be decreased when it is combined with Siltuximab.	Approved
Omeprazole	The serum concentration of Omeprazole can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Ondansetron	The serum concentration of Ondansetron can be decreased when it is combined with Siltuximab.	Approved
Orphenadrine	The serum concentration of Orphenadrine can be decreased when it is combined with Siltuximab.	Approved
Ospemifene	The serum concentration of Ospemifene can be decreased when it is combined with Siltuximab.	Approved
Ouabain	Ouabain may decrease the cardiotoxic activities of Siltuximab.	Approved
Oxazepam	The serum concentration of Oxazepam can be decreased when it is combined with Siltuximab.	Approved
Oxybutynin	The serum concentration of Oxybutynin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Oxycodone	The serum concentration of Oxycodone can be decreased when it is combined with Siltuximab.	Approved, Illicit, Investigational
Oxymorphone	The serum concentration of Oxymorphone can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Paclitaxel	The serum concentration of Paclitaxel can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Palbociclib	The serum concentration of Palbociclib can be decreased when it is combined with Siltuximab.	Approved
Palonosetron	The serum concentration of Palonosetron can be decreased when it is combined with Siltuximab.	Approved, Investigational
Panobinostat	The serum concentration of Panobinostat can be decreased when it is combined with Siltuximab.	Approved, Investigational
Pantoprazole	The serum concentration of Pantoprazole can be decreased when it is combined with Siltuximab.	Approved
Paramethadione	The serum concentration of Paramethadione can be decreased when it is combined with Siltuximab.	Approved
Paramethasone	The serum concentration of Paramethasone can be decreased when it is combined with Siltuximab.	Approved
Parecoxib	The serum concentration of Parecoxib can be decreased when it is combined with Siltuximab.	Approved
Paricalcitol	The serum concentration of Paricalcitol can be decreased when it is combined with Siltuximab.	Approved, Investigational
Paritaprevir	The serum concentration of Paritaprevir can be decreased when it is combined with Siltuximab.	Approved
Pazopanib	The serum concentration of Pazopanib can be decreased when it is combined with Siltuximab.	Approved
Pentamidine	The serum concentration of Pentamidine can be decreased when it is combined with Siltuximab.	Approved
Perampanel	The serum concentration of Perampanel can be decreased when it is combined with Siltuximab.	Approved
Pergolide	The serum concentration of Pergolide can be decreased when it is combined with Siltuximab.	Approved, Vet Approved, Withdrawn
Perhexiline	The serum concentration of Perhexiline can be decreased when it is combined with Siltuximab.	Approved
Permethrin	The serum concentration of Permethrin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Perphenazine	The serum concentration of Perphenazine can be decreased when it is combined with Siltuximab.	Approved
Pethidine	The serum concentration of Pethidine can be decreased when it is combined with Siltuximab.	Approved
Phenacetin	The serum concentration of Phenacetin can be decreased when it is combined with Siltuximab.	Withdrawn
Phenoxybenzamine	The serum concentration of Phenoxybenzamine can be decreased when it is combined with Siltuximab.	Approved
Phenprocoumon	The serum concentration of Phenprocoumon can be decreased when it is combined with Siltuximab.	Approved
Phenytoin	The serum concentration of Phenytoin can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Pilocarpine	The serum concentration of Pilocarpine can be decreased when it is combined with Siltuximab.	Approved
Pimecrolimus	The risk or severity of adverse effects can be increased when Pimecrolimus is combined with Siltuximab.	Approved, Investigational
Pimozide	The serum concentration of Pimozide can be decreased when it is combined with Siltuximab.	Approved
Pioglitazone	The serum concentration of Pioglitazone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Pipotiazine	The serum concentration of Pipotiazine can be decreased when it is combined with Siltuximab.	Approved
Podofilox	The serum concentration of Podofilox can be decreased when it is combined with Siltuximab.	Approved
Pomalidomide	The serum concentration of Pomalidomide can be decreased when it is combined with Siltuximab.	Approved
Ponatinib	The serum concentration of Ponatinib can be decreased when it is combined with Siltuximab.	Approved
Posaconazole	The serum concentration of Posaconazole can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Prasterone	The serum concentration of Prasterone can be decreased when it is combined with Siltuximab.	Approved, Nutraceutical
Prasugrel	The serum concentration of Prasugrel can be decreased when it is combined with Siltuximab.	Approved
Pravastatin	The serum concentration of Pravastatin can be decreased when it is combined with Siltuximab.	Approved
Prazepam	The serum concentration of Prazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Praziquantel	The serum concentration of Praziquantel can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Prednisolone	The serum concentration of Prednisolone can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Prednisone	The serum concentration of Prednisone can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Primaquine	The serum concentration of Primaquine can be decreased when it is combined with Siltuximab.	Approved
Prochlorperazine	The serum concentration of Prochlorperazine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Progesterone	The serum concentration of Progesterone can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Proguanil	The serum concentration of Proguanil can be decreased when it is combined with Siltuximab.	Approved
Promazine	The serum concentration of Promazine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Propafenone	The serum concentration of Propafenone can be decreased when it is combined with Siltuximab.	Approved
Propofol	The serum concentration of Propofol can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Propranolol	The serum concentration of Propranolol can be decreased when it is combined with Siltuximab.	Approved, Investigational
Pyrazinamide	The serum concentration of Pyrazinamide can be decreased when it is combined with Siltuximab.	Approved
Quazepam	The serum concentration of Quazepam can be decreased when it is combined with Siltuximab.	Approved, Illicit
Quetiapine	The serum concentration of Quetiapine can be decreased when it is combined with Siltuximab.	Approved
Quinacrine	The serum concentration of Quinacrine can be decreased when it is combined with Siltuximab.	Approved
Quinidine	The serum concentration of Quinidine can be decreased when it is combined with Siltuximab.	Approved
Quinine	The serum concentration of Quinine can be decreased when it is combined with Siltuximab.	Approved
Rabeprazole	The serum concentration of Rabeprazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Raloxifene	The serum concentration of Raloxifene can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ramelteon	The serum concentration of Ramelteon can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ranolazine	The serum concentration of Ranolazine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Reboxetine	The serum concentration of Reboxetine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Regorafenib	The serum concentration of Regorafenib can be decreased when it is combined with Siltuximab.	Approved
Repaglinide	The serum concentration of Repaglinide can be decreased when it is combined with Siltuximab.	Approved, Investigational
Retapamulin	The serum concentration of Retapamulin can be decreased when it is combined with Siltuximab.	Approved
Rifabutin	The serum concentration of Rifabutin can be decreased when it is combined with Siltuximab.	Approved
Rifampicin	The serum concentration of Rifampicin can be decreased when it is combined with Siltuximab.	Approved
Rilpivirine	The serum concentration of Rilpivirine can be decreased when it is combined with Siltuximab.	Approved
Rimonabant	The serum concentration of Rimonabant can be decreased when it is combined with Siltuximab.	Approved, Investigational
Rindopepimut	The risk or severity of adverse effects can be increased when Siltuximab is combined with CDX-110.	Investigational
Riociguat	The serum concentration of Riociguat can be decreased when it is combined with Siltuximab.	Approved
Risperidone	The serum concentration of Risperidone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ritonavir	The serum concentration of Ritonavir can be decreased when it is combined with Siltuximab.	Approved, Investigational
Rivaroxaban	The serum concentration of Rivaroxaban can be decreased when it is combined with Siltuximab.	Approved
Rofecoxib	The serum concentration of Rofecoxib can be decreased when it is combined with Siltuximab.	Investigational, Withdrawn
Roflumilast	Roflumilast may increase the immunosuppressive activities of Siltuximab.	Approved
Rolapitant	The serum concentration of Rolapitant can be decreased when it is combined with Siltuximab.	Approved
Romidepsin	The serum concentration of Romidepsin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ropinirole	The serum concentration of Ropinirole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ropivacaine	The serum concentration of Ropivacaine can be decreased when it is combined with Siltuximab.	Approved
Rosuvastatin	The serum concentration of Rosuvastatin can be decreased when it is combined with Siltuximab.	Approved
Rotigotine	The serum concentration of Rotigotine can be decreased when it is combined with Siltuximab.	Approved
Roxithromycin	The serum concentration of Roxithromycin can be decreased when it is combined with Siltuximab.	Approved, Withdrawn
Ruxolitinib	The serum concentration of Ruxolitinib can be decreased when it is combined with Siltuximab.	Approved
Salmeterol	The serum concentration of Salmeterol can be decreased when it is combined with Siltuximab.	Approved
Saquinavir	The serum concentration of Saquinavir can be decreased when it is combined with Siltuximab.	Approved, Investigational
Saxagliptin	The serum concentration of Saxagliptin can be decreased when it is combined with Siltuximab.	Approved
Selegiline	The serum concentration of Selegiline can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Selexipag	The serum concentration of Selexipag can be decreased when it is combined with Siltuximab.	Approved
Sertindole	The serum concentration of Sertindole can be decreased when it is combined with Siltuximab.	Approved, Withdrawn
Sertraline	The serum concentration of Sertraline can be decreased when it is combined with Siltuximab.	Approved
Sevoflurane	The serum concentration of Sevoflurane can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Sibutramine	The serum concentration of Sibutramine can be decreased when it is combined with Siltuximab.	Approved, Illicit, Investigational, Withdrawn
Sildenafil	The serum concentration of Sildenafil can be decreased when it is combined with Siltuximab.	Approved, Investigational
Silodosin	The serum concentration of Silodosin can be decreased when it is combined with Siltuximab.	Approved
Simeprevir	The serum concentration of Simeprevir can be decreased when it is combined with Siltuximab.	Approved
Simvastatin	The serum concentration of Simvastatin can be decreased when it is combined with Siltuximab.	Approved
Sipuleucel-T	The therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Siltuximab.	Approved
Sirolimus	The serum concentration of Sirolimus can be decreased when it is combined with Siltuximab.	Approved, Investigational
Sitagliptin	The serum concentration of Sitagliptin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Solifenacin	The serum concentration of Solifenacin can be decreased when it is combined with Siltuximab.	Approved
Sonidegib	The serum concentration of Sonidegib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Sorafenib	The serum concentration of Sorafenib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Spiramycin	The serum concentration of Spiramycin can be decreased when it is combined with Siltuximab.	Approved
SRP 299	The risk or severity of adverse effects can be increased when Siltuximab is combined with SRP 299.	Investigational
Sufentanil	The serum concentration of Sufentanil can be decreased when it is combined with Siltuximab.	Approved, Investigational
Sulfadiazine	The serum concentration of Sulfadiazine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Sulfamethoxazole	The serum concentration of Sulfamethoxazole can be decreased when it is combined with Siltuximab.	Approved
Sulfinpyrazone	The serum concentration of Sulfinpyrazone can be decreased when it is combined with Siltuximab.	Approved
Sunitinib	The serum concentration of Sunitinib can be decreased when it is combined with Siltuximab.	Approved, Investigational
Synthetic Conjugated Estrogens, A	The serum concentration of Synthetic Conjugated Estrogens, A can be decreased when it is combined with Siltuximab.	Approved
Synthetic Conjugated Estrogens, B	The serum concentration of Synthetic Conjugated Estrogens, B can be decreased when it is combined with Siltuximab.	Approved
Tacrolimus	The risk or severity of adverse effects can be increased when Tacrolimus is combined with Siltuximab.	Approved, Investigational
Tacrolimus	The serum concentration of Tacrolimus can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tadalafil	The serum concentration of Tadalafil can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tamoxifen	The serum concentration of Tamoxifen can be decreased when it is combined with Siltuximab.	Approved
Tamsulosin	The serum concentration of Tamsulosin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tasosartan	The serum concentration of Tasosartan can be decreased when it is combined with Siltuximab.	Approved
Telaprevir	The serum concentration of Telaprevir can be decreased when it is combined with Siltuximab.	Withdrawn
Telithromycin	The serum concentration of Telithromycin can be decreased when it is combined with Siltuximab.	Approved
Temazepam	The serum concentration of Temazepam can be decreased when it is combined with Siltuximab.	Approved
Temsirolimus	The serum concentration of Temsirolimus can be decreased when it is combined with Siltuximab.	Approved
Teniposide	The serum concentration of Teniposide can be decreased when it is combined with Siltuximab.	Approved
Terbinafine	The serum concentration of Terbinafine can be decreased when it is combined with Siltuximab.	Approved, Investigational, Vet Approved
Terfenadine	The serum concentration of Terfenadine can be decreased when it is combined with Siltuximab.	Withdrawn
Tesmilifene	The serum concentration of Tesmilifene can be decreased when it is combined with Siltuximab.	Investigational
Testosterone	The serum concentration of Testosterone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tetracycline	The serum concentration of Tetracycline can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Theophylline	The serum concentration of Theophylline can be decreased when it is combined with Siltuximab.	Approved
Thiotepa	The serum concentration of Thiotepa can be decreased when it is combined with Siltuximab.	Approved
Tiagabine	The serum concentration of Tiagabine can be decreased when it is combined with Siltuximab.	Approved
Ticagrelor	The serum concentration of Ticagrelor can be decreased when it is combined with Siltuximab.	Approved
Ticlopidine	The serum concentration of Ticlopidine can be decreased when it is combined with Siltuximab.	Approved
Tinidazole	The serum concentration of Tinidazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tiotropium	The serum concentration of Tiotropium can be decreased when it is combined with Siltuximab.	Approved
Tipranavir	The serum concentration of Tipranavir can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tofacitinib	Siltuximab may increase the immunosuppressive activities of Tofacitinib.	Approved, Investigational
Tolterodine	The serum concentration of Tolterodine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tolvaptan	The serum concentration of Tolvaptan can be decreased when it is combined with Siltuximab.	Approved
Toremifene	The serum concentration of Toremifene can be decreased when it is combined with Siltuximab.	Approved, Investigational
Trabectedin	The serum concentration of Trabectedin can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tramadol	The serum concentration of Tramadol can be decreased when it is combined with Siltuximab.	Approved, Investigational
Trastuzumab	Trastuzumab may increase the cardiotoxic activities of Siltuximab.	Approved, Investigational
Trastuzumab emtansine	The serum concentration of Trastuzumab emtansine can be decreased when it is combined with Siltuximab.	Approved
Trazodone	The serum concentration of Trazodone can be decreased when it is combined with Siltuximab.	Approved, Investigational
Tretinoin	The serum concentration of Tretinoin can be decreased when it is combined with Siltuximab.	Approved, Investigational, Nutraceutical
Triamcinolone	The serum concentration of Triamcinolone can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Triazolam	The serum concentration of Triazolam can be decreased when it is combined with Siltuximab.	Approved
Trimethadione	The serum concentration of Trimethadione can be decreased when it is combined with Siltuximab.	Approved
Trimethoprim	The serum concentration of Trimethoprim can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Trimipramine	The serum concentration of Trimipramine can be decreased when it is combined with Siltuximab.	Approved
Troglitazone	The serum concentration of Troglitazone can be decreased when it is combined with Siltuximab.	Withdrawn
Udenafil	The serum concentration of Udenafil can be decreased when it is combined with Siltuximab.	Approved, Investigational
Ulipristal	The serum concentration of Ulipristal can be decreased when it is combined with Siltuximab.	Approved
Valdecoxib	The serum concentration of Valdecoxib can be decreased when it is combined with Siltuximab.	Investigational, Withdrawn
Vandetanib	The serum concentration of Vandetanib can be decreased when it is combined with Siltuximab.	Approved
Vanoxerine	The serum concentration of Vanoxerine can be decreased when it is combined with Siltuximab.	Investigational
Vardenafil	The serum concentration of Vardenafil can be decreased when it is combined with Siltuximab.	Approved
Vemurafenib	The serum concentration of Vemurafenib can be decreased when it is combined with Siltuximab.	Approved
Venetoclax	The serum concentration of Venetoclax can be decreased when it is combined with Siltuximab.	Approved
Venlafaxine	The serum concentration of Venlafaxine can be decreased when it is combined with Siltuximab.	Approved
Verapamil	The serum concentration of Verapamil can be decreased when it is combined with Siltuximab.	Approved
Vilanterol	The serum concentration of Vilanterol can be decreased when it is combined with Siltuximab.	Approved
Vilazodone	The serum concentration of Vilazodone can be decreased when it is combined with Siltuximab.	Approved
Vinblastine	The serum concentration of Vinblastine can be decreased when it is combined with Siltuximab.	Approved
Vincristine	The serum concentration of Vincristine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Vindesine	The serum concentration of Vindesine can be decreased when it is combined with Siltuximab.	Approved
Vinorelbine	The serum concentration of Vinorelbine can be decreased when it is combined with Siltuximab.	Approved, Investigational
Vismodegib	The serum concentration of Vismodegib can be decreased when it is combined with Siltuximab.	Approved
Voriconazole	The serum concentration of Voriconazole can be decreased when it is combined with Siltuximab.	Approved, Investigational
Vortioxetine	The serum concentration of Vortioxetine can be decreased when it is combined with Siltuximab.	Approved
Warfarin	The serum concentration of Warfarin can be decreased when it is combined with Siltuximab.	Approved
Yohimbine	The serum concentration of Yohimbine can be decreased when it is combined with Siltuximab.	Approved, Vet Approved
Zafirlukast	The serum concentration of Zafirlukast can be decreased when it is combined with Siltuximab.	Approved, Investigational
Zalcitabine	The serum concentration of Zalcitabine can be decreased when it is combined with Siltuximab.	Approved
Zaleplon	The serum concentration of Zaleplon can be decreased when it is combined with Siltuximab.	Approved, Illicit, Investigational
Zidovudine	The serum concentration of Zidovudine can be decreased when it is combined with Siltuximab.	Approved
Zileuton	The serum concentration of Zileuton can be decreased when it is combined with Siltuximab.	Approved, Investigational, Withdrawn
Ziprasidone	The serum concentration of Ziprasidone can be decreased when it is combined with Siltuximab.	Approved
Zolpidem	The serum concentration of Zolpidem can be decreased when it is combined with Siltuximab.	Approved
Zomepirac	The serum concentration of Zomepirac can be decreased when it is combined with Siltuximab.	Withdrawn
Zonisamide	The serum concentration of Zonisamide can be decreased when it is combined with Siltuximab.	Approved, Investigational
Zopiclone	The serum concentration of Zopiclone can be decreased when it is combined with Siltuximab.	Approved

Food Interactions

Not Available

References

Synthesis Reference

Not Available

General References

Puchalski T, Prabhakar U, Jiao Q, Berns B, Davis HM: Pharmacokinetic and pharmacodynamic modeling of an anti-interleukin-6 chimeric monoclonal antibody (siltuximab) in patients with metastatic renal cell carcinoma. Clin Cancer Res. 2010 Mar 1;16(5):1652-61. doi: 10.1158/1078-0432.CCR-09-2581. Epub 2010 Feb 23. [PubMed:20179212 ]
Deisseroth A, Ko CW, Nie L, Zirkelbach JF, Zhao L, Bullock J, Mehrotra N, Del Valle P, Saber H, Sheth C, Gehrke B, Justice R, Farrell A, Pazdur R: FDA approval: siltuximab for the treatment of patients with multicentric Castleman disease. Clin Cancer Res. 2015 Mar 1;21(5):950-4. doi: 10.1158/1078-0432.CCR-14-1678. Epub 2015 Jan 19. [PubMed:25601959 ]
Liu YC, Stone K, van Rhee F: Siltuximab for multicentric Castleman disease. Expert Rev Hematol. 2014 Oct;7(5):545-57. doi: 10.1586/17474086.2014.946402. Epub 2014 Aug 9. [PubMed:25110138 ]

External Links

Resource	Link
Drug Product Database	22547
RxList	http://www.rxlist.com/sylvant-drug.htm
Drugs.com	http://www.drugs.com/cdi/siltuximab.html
Wikipedia	Siltuximab

ATC Codes

L04AC11 — Siltuximab

AHFS Codes

10:00

PDB Entries

Not Available

FDA label

Download (326 KB)

MSDS

Not Available

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Active Not Recruiting	Basic Science	Diabetes, Diabetes Mellitus Type 1	1
0	Withdrawn	Treatment	Agnogenic Myeloid Metaplasia / Polycythemia Vera (PV) / Primary Myelofibrosis / Thrombocytopenias	1
1	Completed	Treatment	Giant Lymph Node Hyperplasia / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
1	Completed	Treatment	Healthy Volunteers	1
1	Completed	Treatment	Monoclonal Gammopathy of Undetermined Significance (MGUS) / Multiple Myeloma (MM) / Plasma Cell Neoplasms	1
1	Completed	Treatment	Prostatic Neoplasms	1
1	Terminated	Treatment	Multiple Myeloma (MM)	1
1, 2	Completed	Treatment	Neoplasms, Colorectal / Neoplasms, Head and Neck / Neoplasms, Lung / Neoplasms, Ovarian / Neoplasms, Pancreatic	1
1, 2	Completed	Treatment	Plasma Cell Myeloma	1
1, 2	Completed	Treatment	Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Treatment	Psychotic Disorder NOS / Schizophrenic Disorders	1
2	Active Not Recruiting	Treatment	High-risk Smoldering Multiple Myeloma	1
2	Active Not Recruiting	Treatment	Multicentric Castleman's Disease	2
2	Active Not Recruiting	Treatment	Multiple Myeloma (MM)	1
2	Completed	Treatment	Malignant Neoplasm of Prostate	1
2	Completed	Treatment	Multiple Myeloma (MM)	2
2	Terminated	Treatment	Malignant Neoplasm of Prostate	1
2	Terminated	Treatment	Myelodysplastic Syndrome	1
2	Withdrawn	Treatment	Renal Cancers	1
3	Withdrawn	Treatment	Multiple Myeloma (MM)	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage forms

Form	Route	Strength
Injection, powder, lyophilized, for solution	Intravenous	100 mg/1
Injection, powder, lyophilized, for solution	Intravenous	400 mg/1
Powder, for solution	Intravenous	100 mg
Powder, for solution	Intravenous	400 mg

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
US7612182	No	2007-08-01	2027-08-01	US

Properties

State

Solid

Experimental Properties

Not Available

Taxonomy

Description

Not Available

Kingdom

Organic Compounds

Super Class

Organic Acids

Class

Carboxylic Acids and Derivatives

Sub Class

Amino Acids, Peptides, and Analogues

Direct Parent

Peptides

Alternative Parents

Not Available

Substituents

Not Available

Molecular Framework

Not Available

External Descriptors

Not Available

Targets

Details

1. Interleukin-6

Kind: Protein
Organism: Human
Pharmacological action: yes
Actions: antagonistantibody

General Function:: Interleukin-6 receptor binding
Specific Function:: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as ...
Gene Name:: IL6
Uniprot ID:: P05231
Molecular Weight:: 23717.965 Da

References

van Zaanen HC, Koopmans RP, Aarden LA, Rensink HJ, Stouthard JM, Warnaar SO, Lokhorst HM, van Oers MH: Endogenous interleukin 6 production in multiple myeloma patients treated with chimeric monoclonal anti-IL6 antibodies indicates the existence of a positive feed-back loop. J Clin Invest. 1996 Sep 15;98(6):1441-8. [PubMed:8823310 ]

Drug created on March 16, 2015 13:35 / Updated on August 17, 2016 12:24

Get DrugBank to go!

Targets

References