Identification

Name
Siltuximab
Accession Number
DB09036
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Siltuximab is a chimeric (human-mouse) monoclonal immunoglobulin G1-kappa antibody produced in a Chinese hamster ovary (CHO) cell line by recombinant DNA technology. Siltuximab prevents the binding of IL-6 to soluble and membrane-bound IL-6 receptors by forming high affinity complexes with human interleukin-6 (IL-6). Its use is indicated for the treatment of adult patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. MCD is a rare blood disorder caused by dysregulated IL-6 production, proliferation of lymphocytes, and subsequent enlargement of the lymph nodes. It is administered as a 1 hour intravenous infusion every 3 weeks.

Protein structure
Db09036
Protein chemical formula
C6450H9932N1688O2016S50
Protein average weight
145000.0 Da
Sequences
>Heavy Chain Sequence
EVQLVESGGKLLKPGGSLKLSCAASGFTFSSFAMSWFRQSPEKRLEWVAEISSGGSYTYY
PDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGLWGYYALDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain Sequence
QIVLIQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATYYCQQWSGYPYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
CLLB8 / CNTO 328 / CNTO-328 / CNTO328
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SylvantInjection, powder, lyophilized, for solution100 mg/1IntravenousJanssen Biotech, Inc.2014-04-23Not applicableUs
SylvantPowder, for solution400 mgIntravenousJanssen Pharmaceuticals2015-03-03Not applicableCanada
SylvantInjection, powder, lyophilized, for solution400 mg/1IntravenousJanssen Biotech, Inc.2014-04-01Not applicableUs
SylvantPowder, for solution100 mgIntravenousJanssen Pharmaceuticals2015-03-03Not applicableCanada
Categories
UNII
T4H8FMA7IM
CAS number
541502-14-1

Pharmacology

Indication

Siltuximab is indicated for the treatment of patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. Siltuximab did not bind to virally produced IL-6 in a nonclinical study and was therefore not studied in patients with MCD who are HIV or HHV-8 positive.

Associated Conditions
Pharmacodynamics

Siltuximab-neutralized antibody-IL-6 complexes interfere with current immunological-based IL-6 quantification methods, therefore measurement of serum or plasma IL-6 concentrations should not be used as a pharmacodynamic marker during treatment. As well, cytochrome P450 enzymes in the liver are down regulated by infection and inflammation stimuli, which includes cytokines such as IL-6. By preventing IL-6 signalling through treatment with siltuximab, CYP450 activity may be increased leading to faster metabolism of drugs that are CYP450 substrates.

Mechanism of action

Siltuximab complexes with human IL-6 and prevents binding to soluble and membrane-bound IL-6 receptors, thereby inhibiting the proliferation of lymphocytes.

TargetActionsOrganism
AInterleukin-6
antagonist
antibody
Human
Absorption
Not Available
Volume of distribution

Based on population pharmacokinetic analysis, the central volume of distribution in a male subject with body weight of 70 kg is 4.5 L.

Protein binding
Not Available
Metabolism

As siltuximab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of elimination
Not Available
Half life

The mean terminal half life after the first intravenous infusion of 11 mg/kg is 20.6 days.

Clearance

Body weight was identified as the only statistically significant covariate of siltuximab clearance, therefore body weight based dosing is appropriate. Based on population pharmacokinetic analysis, the clearance of situximab in patients is 0.23 L/day.

Toxicity

The most common side effects that occurred during siltuximab treatment were pruritis, increased weight, rash, hyperuricemia, and upper respiratory tract infection. Siltuximab should not be administered to patients with severe infections as it may mask signs and symptoms of acute inflammation including suppression of fever and acute phase reactants such as C-reactive protein (CRP). Gastrointestinal perforation has been reported in clinical trials, therefore use with caution in patients who may be at increased risk for GI perforation.

Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Siltuximab.Approved
AbemaciclibThe serum concentration of Abemaciclib can be decreased when it is combined with Siltuximab.Approved, Investigational
AbirateroneThe serum concentration of Abiraterone can be decreased when it is combined with Siltuximab.Approved
AcenocoumarolThe serum concentration of Acenocoumarol can be decreased when it is combined with Siltuximab.Approved, Investigational
AcetaminophenThe serum concentration of Acetaminophen can be decreased when it is combined with Siltuximab.Approved
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Siltuximab.Approved
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Siltuximab.Experimental
AdalimumabThe risk or severity of adverse effects can be increased when Siltuximab is combined with Adalimumab.Approved
AdinazolamThe serum concentration of Adinazolam can be decreased when it is combined with Siltuximab.Approved
AgmatineThe serum concentration of Agmatine can be decreased when it is combined with Siltuximab.Experimental, Investigational
AlbendazoleThe serum concentration of Albendazole can be decreased when it is combined with Siltuximab.Approved, Vet Approved
AlclometasoneThe serum concentration of Alclometasone can be decreased when it is combined with Siltuximab.Approved
AldesleukinThe risk or severity of adverse effects can be increased when Siltuximab is combined with Aldesleukin.Approved
AlfentanilThe serum concentration of Alfentanil can be decreased when it is combined with Siltuximab.Approved, Illicit
AlfuzosinThe serum concentration of Alfuzosin can be decreased when it is combined with Siltuximab.Approved, Investigational
AliskirenThe serum concentration of Aliskiren can be decreased when it is combined with Siltuximab.Approved, Investigational
AllylestrenolThe serum concentration of Allylestrenol can be decreased when it is combined with Siltuximab.Approved
AlmotriptanThe serum concentration of Almotriptan can be decreased when it is combined with Siltuximab.Approved, Investigational
AlogliptinThe serum concentration of Alogliptin can be decreased when it is combined with Siltuximab.Approved
AlosetronThe serum concentration of Alosetron can be decreased when it is combined with Siltuximab.Approved, Withdrawn
alpha-Tocopherol acetateThe serum concentration of alpha-Tocopherol acetate can be decreased when it is combined with Siltuximab.Approved
AlprazolamThe serum concentration of Alprazolam can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
AmbrisentanThe serum concentration of Ambrisentan can be decreased when it is combined with Siltuximab.Approved, Investigational
AmbroxolThe serum concentration of Ambroxol can be decreased when it is combined with Siltuximab.Approved, Investigational
AminophenazoneThe serum concentration of Aminophenazone can be decreased when it is combined with Siltuximab.Approved, Withdrawn
AminophyllineThe serum concentration of Aminophylline can be decreased when it is combined with Siltuximab.Approved
AmiodaroneThe serum concentration of Amiodarone can be decreased when it is combined with Siltuximab.Approved, Investigational
AmitriptylineThe serum concentration of Amitriptyline can be decreased when it is combined with Siltuximab.Approved
AmlodipineThe serum concentration of Amlodipine can be decreased when it is combined with Siltuximab.Approved
AmprenavirThe serum concentration of Amprenavir can be decreased when it is combined with Siltuximab.Approved, Investigational
AnakinraThe risk or severity of adverse effects can be increased when Siltuximab is combined with Anakinra.Approved
AncestimThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Siltuximab.Approved, Investigational, Withdrawn
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Siltuximab is combined with Anthrax immune globulin human.Approved
AntipyrineThe serum concentration of Antipyrine can be decreased when it is combined with Siltuximab.Approved, Investigational
ApalutamideThe serum concentration of Apalutamide can be decreased when it is combined with Siltuximab.Approved, Investigational
ApixabanThe serum concentration of Apixaban can be decreased when it is combined with Siltuximab.Approved
ApremilastThe serum concentration of Apremilast can be decreased when it is combined with Siltuximab.Approved, Investigational
AprepitantThe serum concentration of Aprepitant can be decreased when it is combined with Siltuximab.Approved, Investigational
AranidipineThe serum concentration of Aranidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
ArgatrobanThe serum concentration of Argatroban can be decreased when it is combined with Siltuximab.Approved, Investigational
AripiprazoleThe serum concentration of Aripiprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
ArtemetherThe serum concentration of Artemether can be decreased when it is combined with Siltuximab.Approved
AsenapineThe serum concentration of Asenapine can be decreased when it is combined with Siltuximab.Approved
AstemizoleThe serum concentration of Astemizole can be decreased when it is combined with Siltuximab.Approved, Withdrawn
AsunaprevirThe serum concentration of Asunaprevir can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
AtazanavirThe serum concentration of Atazanavir can be decreased when it is combined with Siltuximab.Approved, Investigational
AtorvastatinThe serum concentration of Atorvastatin can be decreased when it is combined with Siltuximab.Approved
AvanafilThe serum concentration of Avanafil can be decreased when it is combined with Siltuximab.Approved
AvatrombopagThe serum concentration of Avatrombopag can be decreased when it is combined with Siltuximab.Approved, Investigational
AxitinibThe serum concentration of Axitinib can be decreased when it is combined with Siltuximab.Approved, Investigational
AzelastineThe serum concentration of Azelastine can be decreased when it is combined with Siltuximab.Approved
AzelnidipineThe serum concentration of Azelnidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
AzithromycinThe serum concentration of Azithromycin can be decreased when it is combined with Siltuximab.Approved
Bacillus calmette-guerin substrain connaught live antigenThe risk or severity of adverse effects can be increased when Siltuximab is combined with Bacillus calmette-guerin substrain connaught live antigen.Approved, Investigational
Bacillus calmette-guerin substrain tice live antigenThe risk or severity of adverse effects can be increased when Siltuximab is combined with Bacillus calmette-guerin substrain tice live antigen.Approved
BanoxantroneThe serum concentration of Banoxantrone can be decreased when it is combined with Siltuximab.Investigational
BaricitinibThe serum concentration of Baricitinib can be decreased when it is combined with Siltuximab.Approved, Investigational
BarnidipineThe serum concentration of Barnidipine can be decreased when it is combined with Siltuximab.Approved
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Siltuximab.Investigational
Beclomethasone dipropionateThe serum concentration of Beclomethasone dipropionate can be decreased when it is combined with Siltuximab.Approved, Investigational
BedaquilineThe serum concentration of Bedaquiline can be decreased when it is combined with Siltuximab.Approved
BencyclaneThe serum concentration of Bencyclane can be decreased when it is combined with Siltuximab.Experimental
BenidipineThe serum concentration of Benidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
BenzphetamineThe serum concentration of Benzphetamine can be decreased when it is combined with Siltuximab.Approved, Illicit
Benzyl alcoholThe serum concentration of Benzyl alcohol can be decreased when it is combined with Siltuximab.Approved
BepridilThe serum concentration of Bepridil can be decreased when it is combined with Siltuximab.Approved, Withdrawn
BevacizumabBevacizumab may increase the cardiotoxic activities of Siltuximab.Approved, Investigational
BexaroteneThe serum concentration of Bexarotene can be decreased when it is combined with Siltuximab.Approved, Investigational
BezafibrateThe serum concentration of Bezafibrate can be decreased when it is combined with Siltuximab.Approved, Investigational
BicalutamideThe serum concentration of Bicalutamide can be decreased when it is combined with Siltuximab.Approved
BictegravirThe serum concentration of Bictegravir can be decreased when it is combined with Siltuximab.Approved, Investigational
BioallethrinThe serum concentration of Bioallethrin can be decreased when it is combined with Siltuximab.Approved, Experimental
BisoprololThe serum concentration of Bisoprolol can be decreased when it is combined with Siltuximab.Approved
BlonanserinThe serum concentration of Blonanserin can be decreased when it is combined with Siltuximab.Approved, Investigational
BoceprevirThe serum concentration of Boceprevir can be decreased when it is combined with Siltuximab.Approved, Withdrawn
BortezomibThe serum concentration of Bortezomib can be decreased when it is combined with Siltuximab.Approved, Investigational
BosentanThe serum concentration of Bosentan can be decreased when it is combined with Siltuximab.Approved, Investigational
BosutinibThe serum concentration of Bosutinib can be decreased when it is combined with Siltuximab.Approved
Brentuximab vedotinThe serum concentration of Brentuximab vedotin can be decreased when it is combined with Siltuximab.Approved, Investigational
BrexpiprazoleThe serum concentration of Brexpiprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
BrigatinibThe serum concentration of Brigatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
BrinzolamideThe serum concentration of Brinzolamide can be decreased when it is combined with Siltuximab.Approved
BrivaracetamThe serum concentration of Brivaracetam can be decreased when it is combined with Siltuximab.Approved, Investigational
BromazepamThe serum concentration of Bromazepam can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
BromocriptineThe serum concentration of Bromocriptine can be decreased when it is combined with Siltuximab.Approved, Investigational
BrompheniramineThe serum concentration of Brompheniramine can be decreased when it is combined with Siltuximab.Approved
BudesonideThe serum concentration of Budesonide can be decreased when it is combined with Siltuximab.Approved
BupivacaineThe serum concentration of Bupivacaine can be decreased when it is combined with Siltuximab.Approved, Investigational
BuprenorphineThe serum concentration of Buprenorphine can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Vet Approved
BupropionThe serum concentration of Bupropion can be decreased when it is combined with Siltuximab.Approved
BuspironeThe serum concentration of Buspirone can be decreased when it is combined with Siltuximab.Approved, Investigational
BusulfanThe serum concentration of Busulfan can be decreased when it is combined with Siltuximab.Approved, Investigational
CabazitaxelThe serum concentration of Cabazitaxel can be decreased when it is combined with Siltuximab.Approved
CabergolineThe serum concentration of Cabergoline can be decreased when it is combined with Siltuximab.Approved
CabozantinibThe serum concentration of Cabozantinib can be decreased when it is combined with Siltuximab.Approved, Investigational
CaffeineThe serum concentration of Caffeine can be decreased when it is combined with Siltuximab.Approved
CalcitriolThe serum concentration of Calcitriol can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
CanagliflozinThe serum concentration of Canagliflozin can be decreased when it is combined with Siltuximab.Approved
CannabidiolThe serum concentration of Cannabidiol can be decreased when it is combined with Siltuximab.Approved, Investigational
CarbamazepineThe serum concentration of Carbamazepine can be decreased when it is combined with Siltuximab.Approved, Investigational
CarbinoxamineThe serum concentration of Carbinoxamine can be decreased when it is combined with Siltuximab.Approved
CarboxyamidotriazoleThe serum concentration of Carboxyamidotriazole can be decreased when it is combined with Siltuximab.Investigational
CariprazineThe serum concentration of Cariprazine can be decreased when it is combined with Siltuximab.Approved, Investigational
CaroverineThe serum concentration of Caroverine can be decreased when it is combined with Siltuximab.Experimental
CarvedilolThe serum concentration of Carvedilol can be decreased when it is combined with Siltuximab.Approved, Investigational
CelecoxibThe serum concentration of Celecoxib can be decreased when it is combined with Siltuximab.Approved, Investigational
CeliprololThe serum concentration of Celiprolol can be decreased when it is combined with Siltuximab.Approved, Investigational
CephalexinThe serum concentration of Cephalexin can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
CerivastatinThe serum concentration of Cerivastatin can be decreased when it is combined with Siltuximab.Approved, Withdrawn
CetuximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Siltuximab.Approved
CevimelineThe serum concentration of Cevimeline can be decreased when it is combined with Siltuximab.Approved
Chenodeoxycholic acidThe serum concentration of Chenodeoxycholic acid can be decreased when it is combined with Siltuximab.Approved
ChlordiazepoxideThe serum concentration of Chlordiazepoxide can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
ChloroquineThe serum concentration of Chloroquine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
ChlorphenamineThe serum concentration of Chlorphenamine can be decreased when it is combined with Siltuximab.Approved
ChlorpromazineThe serum concentration of Chlorpromazine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
ChlorzoxazoneThe serum concentration of Chlorzoxazone can be decreased when it is combined with Siltuximab.Approved
CholecalciferolThe serum concentration of Cholecalciferol can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
CiclesonideThe serum concentration of Ciclesonide can be decreased when it is combined with Siltuximab.Approved, Investigational
CilnidipineThe serum concentration of Cilnidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
CilostazolThe serum concentration of Cilostazol can be decreased when it is combined with Siltuximab.Approved, Investigational
CinacalcetThe serum concentration of Cinacalcet can be decreased when it is combined with Siltuximab.Approved
CinnarizineThe serum concentration of Cinnarizine can be decreased when it is combined with Siltuximab.Approved, Investigational
CisaprideThe serum concentration of Cisapride can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
CitalopramThe serum concentration of Citalopram can be decreased when it is combined with Siltuximab.Approved
ClarithromycinThe serum concentration of Clarithromycin can be decreased when it is combined with Siltuximab.Approved
ClevidipineThe serum concentration of Clevidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
ClindamycinThe serum concentration of Clindamycin can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ClobazamThe serum concentration of Clobazam can be decreased when it is combined with Siltuximab.Approved, Illicit
ClofazimineThe serum concentration of Clofazimine can be decreased when it is combined with Siltuximab.Approved, Investigational
ClofibrateThe serum concentration of Clofibrate can be decreased when it is combined with Siltuximab.Approved, Investigational
clomethiazoleThe serum concentration of clomethiazole can be decreased when it is combined with Siltuximab.Investigational
ClomipramineThe serum concentration of Clomipramine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
ClonazepamThe serum concentration of Clonazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
ClonidineThe serum concentration of Clonidine can be decreased when it is combined with Siltuximab.Approved
ClopidogrelThe serum concentration of Clopidogrel can be decreased when it is combined with Siltuximab.Approved
ClorazepateThe serum concentration of Clorazepate can be decreased when it is combined with Siltuximab.Approved, Illicit
Clostridium tetani toxoid antigen (formaldehyde inactivated)The risk or severity of adverse effects can be increased when Siltuximab is combined with Clostridium tetani toxoid antigen (formaldehyde inactivated).Approved
ClotiazepamThe serum concentration of Clotiazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
ClozapineThe serum concentration of Clozapine can be decreased when it is combined with Siltuximab.Approved
CocaineThe serum concentration of Cocaine can be decreased when it is combined with Siltuximab.Approved, Illicit
CodeineThe serum concentration of Codeine can be decreased when it is combined with Siltuximab.Approved, Illicit
ColchicineThe serum concentration of Colchicine can be decreased when it is combined with Siltuximab.Approved
ConivaptanThe serum concentration of Conivaptan can be decreased when it is combined with Siltuximab.Approved, Investigational
Conjugated estrogensThe serum concentration of Conjugated estrogens can be decreased when it is combined with Siltuximab.Approved
CopanlisibThe serum concentration of Copanlisib can be decreased when it is combined with Siltuximab.Approved, Investigational
Cortisone acetateThe serum concentration of Cortisone acetate can be decreased when it is combined with Siltuximab.Approved, Investigational
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The risk or severity of adverse effects can be increased when Siltuximab is combined with Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated).Approved
CrizotinibThe serum concentration of Crizotinib can be decreased when it is combined with Siltuximab.Approved
CyclandelateThe serum concentration of Cyclandelate can be decreased when it is combined with Siltuximab.Approved
CyclobenzaprineThe serum concentration of Cyclobenzaprine can be decreased when it is combined with Siltuximab.Approved
CyclophosphamideThe serum concentration of Cyclophosphamide can be decreased when it is combined with Siltuximab.Approved, Investigational
CyclosporineThe serum concentration of Cyclosporine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
CymarinCymarin may decrease the cardiotoxic activities of Siltuximab.Experimental
CytarabineThe serum concentration of Cytarabine can be decreased when it is combined with Siltuximab.Approved, Investigational
DabrafenibThe serum concentration of Dabrafenib can be decreased when it is combined with Siltuximab.Approved, Investigational
DaclatasvirThe serum concentration of Daclatasvir can be decreased when it is combined with Siltuximab.Approved, Investigational
DantroleneThe serum concentration of Dantrolene can be decreased when it is combined with Siltuximab.Approved, Investigational
DapagliflozinThe serum concentration of Dapagliflozin can be decreased when it is combined with Siltuximab.Approved
DapsoneThe serum concentration of Dapsone can be decreased when it is combined with Siltuximab.Approved, Investigational
DarifenacinThe serum concentration of Darifenacin can be decreased when it is combined with Siltuximab.Approved, Investigational
DarodipineThe serum concentration of Darodipine can be decreased when it is combined with Siltuximab.Experimental
DarunavirThe serum concentration of Darunavir can be decreased when it is combined with Siltuximab.Approved
DasabuvirThe serum concentration of Dasabuvir can be decreased when it is combined with Siltuximab.Approved
DasatinibThe serum concentration of Dasatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
DaunorubicinThe serum concentration of Daunorubicin can be decreased when it is combined with Siltuximab.Approved
DeflazacortThe serum concentration of Deflazacort can be decreased when it is combined with Siltuximab.Approved, Investigational
DelamanidThe serum concentration of Delamanid can be decreased when it is combined with Siltuximab.Approved, Investigational
DelavirdineThe serum concentration of Delavirdine can be decreased when it is combined with Siltuximab.Approved
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Siltuximab.Approved
DeslanosideDeslanoside may decrease the cardiotoxic activities of Siltuximab.Approved
DesvenlafaxineThe serum concentration of Desvenlafaxine can be decreased when it is combined with Siltuximab.Approved, Investigational
DeutetrabenazineThe serum concentration of Deutetrabenazine can be decreased when it is combined with Siltuximab.Approved, Investigational
DexamethasoneThe serum concentration of Dexamethasone can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
Dexchlorpheniramine maleateThe serum concentration of Dexchlorpheniramine maleate can be decreased when it is combined with Siltuximab.Approved
DexlansoprazoleThe serum concentration of Dexlansoprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
DexniguldipineThe serum concentration of Dexniguldipine can be decreased when it is combined with Siltuximab.Experimental
DextromethorphanThe serum concentration of Dextromethorphan can be decreased when it is combined with Siltuximab.Approved
DextropropoxypheneThe serum concentration of Dextropropoxyphene can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Withdrawn
DexverapamilThe serum concentration of Dexverapamil can be decreased when it is combined with Siltuximab.Experimental
DiazepamThe serum concentration of Diazepam can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Vet Approved
DiclofenacThe serum concentration of Diclofenac can be decreased when it is combined with Siltuximab.Approved, Vet Approved
DienogestThe serum concentration of Dienogest can be decreased when it is combined with Siltuximab.Approved
DigitoxinThe serum concentration of Digitoxin can be decreased when it is combined with Siltuximab.Approved, Investigational
DigoxinThe serum concentration of Digoxin can be decreased when it is combined with Siltuximab.Approved
Digoxin Immune Fab (Ovine)Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Siltuximab.Approved
Dihydro-alpha-ergocryptineThe serum concentration of Dihydro-alpha-ergocryptine can be decreased when it is combined with Siltuximab.Approved
DihydrocodeineThe serum concentration of Dihydrocodeine can be decreased when it is combined with Siltuximab.Approved, Illicit
DihydroergotamineThe serum concentration of Dihydroergotamine can be decreased when it is combined with Siltuximab.Approved, Investigational
DiltiazemThe serum concentration of Diltiazem can be decreased when it is combined with Siltuximab.Approved, Investigational
DisopyramideThe serum concentration of Disopyramide can be decreased when it is combined with Siltuximab.Approved
DisulfiramThe serum concentration of Disulfiram can be decreased when it is combined with Siltuximab.Approved
DocetaxelThe serum concentration of Docetaxel can be decreased when it is combined with Siltuximab.Approved, Investigational
DofetilideThe serum concentration of Dofetilide can be decreased when it is combined with Siltuximab.Approved, Investigational
DolasetronThe serum concentration of Dolasetron can be decreased when it is combined with Siltuximab.Approved, Investigational
DomperidoneThe serum concentration of Domperidone can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
DonepezilThe serum concentration of Donepezil can be decreased when it is combined with Siltuximab.Approved
DorzolamideThe serum concentration of Dorzolamide can be decreased when it is combined with Siltuximab.Approved
DotarizineThe serum concentration of Dotarizine can be decreased when it is combined with Siltuximab.Investigational
DoxepinThe serum concentration of Doxepin can be decreased when it is combined with Siltuximab.Approved, Investigational
DoxorubicinThe serum concentration of Doxorubicin can be decreased when it is combined with Siltuximab.Approved, Investigational
DronabinolThe serum concentration of Dronabinol can be decreased when it is combined with Siltuximab.Approved, Illicit
DronedaroneThe serum concentration of Dronedarone can be decreased when it is combined with Siltuximab.Approved
DutasterideThe serum concentration of Dutasteride can be decreased when it is combined with Siltuximab.Approved, Investigational
EfavirenzThe serum concentration of Efavirenz can be decreased when it is combined with Siltuximab.Approved, Investigational
EfonidipineThe serum concentration of Efonidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
ElbasvirThe serum concentration of Elbasvir can be decreased when it is combined with Siltuximab.Approved
EletriptanThe serum concentration of Eletriptan can be decreased when it is combined with Siltuximab.Approved, Investigational
EliglustatThe serum concentration of Eliglustat can be decreased when it is combined with Siltuximab.Approved
ElvitegravirThe serum concentration of Elvitegravir can be decreased when it is combined with Siltuximab.Approved
EmopamilThe serum concentration of Emopamil can be decreased when it is combined with Siltuximab.Experimental
EnalaprilThe serum concentration of Enalapril can be decreased when it is combined with Siltuximab.Approved, Vet Approved
EnasidenibThe serum concentration of Enasidenib can be decreased when it is combined with Siltuximab.Approved, Investigational
EnzalutamideThe serum concentration of Enzalutamide can be decreased when it is combined with Siltuximab.Approved
EperisoneThe serum concentration of Eperisone can be decreased when it is combined with Siltuximab.Approved, Investigational
EpinastineThe serum concentration of Epinastine can be decreased when it is combined with Siltuximab.Approved, Investigational
EplerenoneThe serum concentration of Eplerenone can be decreased when it is combined with Siltuximab.Approved
ErgocalciferolThe serum concentration of Ergocalciferol can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
Ergoloid mesylateThe serum concentration of Ergoloid mesylate can be decreased when it is combined with Siltuximab.Approved
ErgonovineThe serum concentration of Ergonovine can be decreased when it is combined with Siltuximab.Approved
ErgotamineThe serum concentration of Ergotamine can be decreased when it is combined with Siltuximab.Approved
ErlotinibThe serum concentration of Erlotinib can be decreased when it is combined with Siltuximab.Approved, Investigational
ErythromycinThe serum concentration of Erythromycin can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
EscitalopramThe serum concentration of Escitalopram can be decreased when it is combined with Siltuximab.Approved, Investigational
EsomeprazoleThe serum concentration of Esomeprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
EstazolamThe serum concentration of Estazolam can be decreased when it is combined with Siltuximab.Approved, Illicit
EstradiolThe serum concentration of Estradiol can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
Estradiol acetateThe serum concentration of Estradiol acetate can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
Estradiol benzoateThe serum concentration of Estradiol benzoate can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
Estradiol cypionateThe serum concentration of Estradiol cypionate can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
Estradiol dienanthateThe serum concentration of Estradiol dienanthate can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
Estradiol valerateThe serum concentration of Estradiol valerate can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
EstramustineThe serum concentration of Estramustine can be decreased when it is combined with Siltuximab.Approved, Investigational
Estrogens, esterifiedThe serum concentration of Estrogens, esterified can be decreased when it is combined with Siltuximab.Approved
EstroneThe serum concentration of Estrone can be decreased when it is combined with Siltuximab.Approved
Estrone sulfateThe serum concentration of Estrone sulfate can be decreased when it is combined with Siltuximab.Approved
EszopicloneThe serum concentration of Eszopiclone can be decreased when it is combined with Siltuximab.Approved, Investigational
EtanerceptThe risk or severity of adverse effects can be increased when Etanercept is combined with Siltuximab.Approved, Investigational
EthanolThe serum concentration of Ethanol can be decreased when it is combined with Siltuximab.Approved
Ethinyl EstradiolThe serum concentration of Ethinyl Estradiol can be decreased when it is combined with Siltuximab.Approved
EthosuximideThe serum concentration of Ethosuximide can be decreased when it is combined with Siltuximab.Approved
EthylmorphineThe serum concentration of Ethylmorphine can be decreased when it is combined with Siltuximab.Approved, Illicit
EtizolamThe serum concentration of Etizolam can be decreased when it is combined with Siltuximab.Approved
EtonogestrelThe serum concentration of Etonogestrel can be decreased when it is combined with Siltuximab.Approved, Investigational
EtoposideThe serum concentration of Etoposide can be decreased when it is combined with Siltuximab.Approved
EtoricoxibThe serum concentration of Etoricoxib can be decreased when it is combined with Siltuximab.Approved, Investigational
EtravirineThe serum concentration of Etravirine can be decreased when it is combined with Siltuximab.Approved
EverolimusThe serum concentration of Everolimus can be decreased when it is combined with Siltuximab.Approved
ExemestaneThe serum concentration of Exemestane can be decreased when it is combined with Siltuximab.Approved, Investigational
FamciclovirThe serum concentration of Famciclovir can be decreased when it is combined with Siltuximab.Approved, Investigational
FelbamateThe serum concentration of Felbamate can be decreased when it is combined with Siltuximab.Approved
FelodipineThe serum concentration of Felodipine can be decreased when it is combined with Siltuximab.Approved, Investigational
FendilineThe serum concentration of Fendiline can be decreased when it is combined with Siltuximab.Withdrawn
FenofibrateThe serum concentration of Fenofibrate can be decreased when it is combined with Siltuximab.Approved
FentanylThe serum concentration of Fentanyl can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Vet Approved
FesoterodineThe serum concentration of Fesoterodine can be decreased when it is combined with Siltuximab.Approved
FinasterideThe serum concentration of Finasteride can be decreased when it is combined with Siltuximab.Approved
FingolimodSiltuximab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
Fish oilThe serum concentration of Fish oil can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
FlibanserinThe serum concentration of Flibanserin can be decreased when it is combined with Siltuximab.Approved, Investigational
FlunarizineThe serum concentration of Flunarizine can be decreased when it is combined with Siltuximab.Approved
FlunisolideThe serum concentration of Flunisolide can be decreased when it is combined with Siltuximab.Approved, Investigational
FlunitrazepamThe serum concentration of Flunitrazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
FluorometholoneThe serum concentration of Fluorometholone can be decreased when it is combined with Siltuximab.Approved, Investigational
FluoxetineThe serum concentration of Fluoxetine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
FlurazepamThe serum concentration of Flurazepam can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
FluspirileneThe serum concentration of Fluspirilene can be decreased when it is combined with Siltuximab.Approved, Investigational
FlutamideThe serum concentration of Flutamide can be decreased when it is combined with Siltuximab.Approved, Investigational
Fluticasone furoateThe serum concentration of Fluticasone furoate can be decreased when it is combined with Siltuximab.Approved
Fluticasone propionateThe serum concentration of Fluticasone propionate can be decreased when it is combined with Siltuximab.Approved
FluvastatinThe serum concentration of Fluvastatin can be decreased when it is combined with Siltuximab.Approved
FosamprenavirThe serum concentration of Fosamprenavir can be decreased when it is combined with Siltuximab.Approved
FosnetupitantThe serum concentration of Fosnetupitant can be decreased when it is combined with Siltuximab.Approved
FostamatinibThe serum concentration of Fostamatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
FulvestrantThe serum concentration of Fulvestrant can be decreased when it is combined with Siltuximab.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Siltuximab is combined with G17DT.Investigational
GabapentinThe serum concentration of Gabapentin can be decreased when it is combined with Siltuximab.Approved, Investigational
GalantamineThe serum concentration of Galantamine can be decreased when it is combined with Siltuximab.Approved
GallopamilThe serum concentration of Gallopamil can be decreased when it is combined with Siltuximab.Investigational
GefitinibThe serum concentration of Gefitinib can be decreased when it is combined with Siltuximab.Approved, Investigational
GemcitabineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Gemcitabine.Approved
GemfibrozilThe serum concentration of Gemfibrozil can be decreased when it is combined with Siltuximab.Approved
Gemtuzumab ozogamicinThe risk or severity of adverse effects can be increased when Siltuximab is combined with Gemtuzumab ozogamicin.Approved, Investigational
GI-5005The risk or severity of adverse effects can be increased when Siltuximab is combined with GI-5005.Investigational
GitoformateGitoformate may decrease the cardiotoxic activities of Siltuximab.Experimental
GlipizideThe serum concentration of Glipizide can be decreased when it is combined with Siltuximab.Approved, Investigational
GlyburideThe serum concentration of Glyburide can be decreased when it is combined with Siltuximab.Approved
GranisetronThe serum concentration of Granisetron can be decreased when it is combined with Siltuximab.Approved, Investigational
GrazoprevirThe serum concentration of Grazoprevir can be decreased when it is combined with Siltuximab.Approved
GrepafloxacinThe serum concentration of Grepafloxacin can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
GuanfacineThe serum concentration of Guanfacine can be decreased when it is combined with Siltuximab.Approved, Investigational
HalofantrineThe serum concentration of Halofantrine can be decreased when it is combined with Siltuximab.Approved
HaloperidolThe serum concentration of Haloperidol can be decreased when it is combined with Siltuximab.Approved
HalothaneThe serum concentration of Halothane can be decreased when it is combined with Siltuximab.Approved, Vet Approved
Hepatitis A VaccineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Hepatitis A Vaccine.Approved
Hepatitis B Vaccine (Recombinant)The risk or severity of adverse effects can be increased when Siltuximab is combined with Hepatitis B Vaccine (Recombinant).Approved, Withdrawn
HexobarbitalThe serum concentration of Hexobarbital can be decreased when it is combined with Siltuximab.Approved
HistamineThe serum concentration of Histamine can be decreased when it is combined with Siltuximab.Approved, Investigational
Human rabies virus immune globulinThe risk or severity of adverse effects can be increased when Siltuximab is combined with Human rabies virus immune globulin.Approved
HydrocodoneThe serum concentration of Hydrocodone can be decreased when it is combined with Siltuximab.Approved, Illicit
HydrocortisoneThe serum concentration of Hydrocortisone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
Hydrocortisone acetateThe serum concentration of Hydrocortisone acetate can be decreased when it is combined with Siltuximab.Approved, Vet Approved
Hydrocortisone butyrateThe serum concentration of Hydrocortisone butyrate can be decreased when it is combined with Siltuximab.Approved, Vet Approved
HydromorphoneThe serum concentration of Hydromorphone can be decreased when it is combined with Siltuximab.Approved, Illicit
Hydroxyprogesterone caproateThe serum concentration of Hydroxyprogesterone caproate can be decreased when it is combined with Siltuximab.Approved, Investigational
IbrutinibThe serum concentration of Ibrutinib can be decreased when it is combined with Siltuximab.Approved
IcotinibThe serum concentration of Icotinib can be decreased when it is combined with Siltuximab.Approved, Investigational
IfosfamideThe serum concentration of Ifosfamide can be decreased when it is combined with Siltuximab.Approved
IloperidoneThe serum concentration of Iloperidone can be decreased when it is combined with Siltuximab.Approved
ImatinibThe serum concentration of Imatinib can be decreased when it is combined with Siltuximab.Approved
ImidafenacinThe serum concentration of Imidafenacin can be decreased when it is combined with Siltuximab.Approved, Investigational
ImipramineThe serum concentration of Imipramine can be decreased when it is combined with Siltuximab.Approved
ImiquimodThe serum concentration of Imiquimod can be decreased when it is combined with Siltuximab.Approved, Investigational
Immune Globulin HumanThe risk or severity of adverse effects can be increased when Immune Globulin Human is combined with Siltuximab.Approved, Investigational
IndacaterolThe serum concentration of Indacaterol can be decreased when it is combined with Siltuximab.Approved
IndapamideThe serum concentration of Indapamide can be decreased when it is combined with Siltuximab.Approved
IndinavirThe serum concentration of Indinavir can be decreased when it is combined with Siltuximab.Approved
INGN 201The risk or severity of adverse effects can be increased when Siltuximab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Siltuximab is combined with INGN 225.Investigational
Interferon alfa-n3The risk or severity of adverse effects can be increased when Siltuximab is combined with Interferon alfa-n3.Approved, Investigational
IpecacThe serum concentration of Ipecac can be decreased when it is combined with Siltuximab.Approved, Withdrawn
IpratropiumThe serum concentration of Ipratropium can be decreased when it is combined with Siltuximab.Approved
IrinotecanThe serum concentration of Irinotecan can be decreased when it is combined with Siltuximab.Approved, Investigational
IsavuconazoleThe serum concentration of Isavuconazole can be decreased when it is combined with Siltuximab.Approved, Investigational
IsavuconazoniumThe serum concentration of Isavuconazonium can be decreased when it is combined with Siltuximab.Approved, Investigational
Isosorbide DinitrateThe serum concentration of Isosorbide Dinitrate can be decreased when it is combined with Siltuximab.Approved, Investigational
Isosorbide MononitrateThe serum concentration of Isosorbide Mononitrate can be decreased when it is combined with Siltuximab.Approved
IsradipineThe serum concentration of Isradipine can be decreased when it is combined with Siltuximab.Approved, Investigational
ItraconazoleThe serum concentration of Itraconazole can be decreased when it is combined with Siltuximab.Approved, Investigational
IvabradineThe serum concentration of Ivabradine can be decreased when it is combined with Siltuximab.Approved
IvacaftorThe serum concentration of Ivacaftor can be decreased when it is combined with Siltuximab.Approved
IvermectinThe serum concentration of Ivermectin can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
IxabepiloneThe serum concentration of Ixabepilone can be decreased when it is combined with Siltuximab.Approved, Investigational
IxazomibThe serum concentration of Ixazomib can be decreased when it is combined with Siltuximab.Approved, Investigational
Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated)The risk or severity of adverse effects can be increased when Siltuximab is combined with Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated).Approved
KetamineThe serum concentration of Ketamine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
KetazolamThe serum concentration of Ketazolam can be decreased when it is combined with Siltuximab.Approved
KetobemidoneThe serum concentration of Ketobemidone can be decreased when it is combined with Siltuximab.Approved, Investigational
KetoconazoleThe serum concentration of Ketoconazole can be decreased when it is combined with Siltuximab.Approved, Investigational
LacidipineThe serum concentration of Lacidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
LamotrigineThe serum concentration of Lamotrigine can be decreased when it is combined with Siltuximab.Approved, Investigational
Lanatoside CLanatoside C may decrease the cardiotoxic activities of Siltuximab.Experimental
LansoprazoleThe serum concentration of Lansoprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
LapatinibThe serum concentration of Lapatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
LaquinimodThe serum concentration of Laquinimod can be decreased when it is combined with Siltuximab.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Siltuximab is combined with Leflunomide.Approved, Investigational
LenvatinibThe serum concentration of Lenvatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
LercanidipineThe serum concentration of Lercanidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
LetrozoleThe serum concentration of Letrozole can be decreased when it is combined with Siltuximab.Approved, Investigational
LeuprolideThe serum concentration of Leuprolide can be decreased when it is combined with Siltuximab.Approved, Investigational
LevetiracetamThe serum concentration of Levetiracetam can be decreased when it is combined with Siltuximab.Approved, Investigational
LevobupivacaineThe serum concentration of Levobupivacaine can be decreased when it is combined with Siltuximab.Approved, Investigational
LevocetirizineThe serum concentration of Levocetirizine can be decreased when it is combined with Siltuximab.Approved
Levomethadyl AcetateThe serum concentration of Levomethadyl Acetate can be decreased when it is combined with Siltuximab.Approved, Investigational
LevomilnacipranThe serum concentration of Levomilnacipran can be decreased when it is combined with Siltuximab.Approved, Investigational
LevonorgestrelThe serum concentration of Levonorgestrel can be decreased when it is combined with Siltuximab.Approved, Investigational
LevothyroxineThe serum concentration of Levothyroxine can be decreased when it is combined with Siltuximab.Approved
LidocaineThe serum concentration of Lidocaine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
LidoflazineThe serum concentration of Lidoflazine can be decreased when it is combined with Siltuximab.Experimental
LisurideThe serum concentration of Lisuride can be decreased when it is combined with Siltuximab.Approved, Investigational
LomerizineThe serum concentration of Lomerizine can be decreased when it is combined with Siltuximab.Experimental
LomitapideThe serum concentration of Lomitapide can be decreased when it is combined with Siltuximab.Approved, Investigational
LoperamideThe serum concentration of Loperamide can be decreased when it is combined with Siltuximab.Approved
LopinavirThe serum concentration of Lopinavir can be decreased when it is combined with Siltuximab.Approved
LoratadineThe serum concentration of Loratadine can be decreased when it is combined with Siltuximab.Approved, Investigational
LorcaserinThe serum concentration of Lorcaserin can be decreased when it is combined with Siltuximab.Approved
LorpiprazoleThe serum concentration of Lorpiprazole can be decreased when it is combined with Siltuximab.Approved
LosartanThe serum concentration of Losartan can be decreased when it is combined with Siltuximab.Approved
LovastatinThe serum concentration of Lovastatin can be decreased when it is combined with Siltuximab.Approved, Investigational
LumefantrineThe serum concentration of Lumefantrine can be decreased when it is combined with Siltuximab.Approved
LurasidoneThe serum concentration of Lurasidone can be decreased when it is combined with Siltuximab.Approved, Investigational
MacimorelinThe serum concentration of Macimorelin can be decreased when it is combined with Siltuximab.Approved, Investigational
MacitentanThe serum concentration of Macitentan can be decreased when it is combined with Siltuximab.Approved
Magnesium sulfateThe serum concentration of Magnesium sulfate can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
ManidipineThe serum concentration of Manidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
MaravirocThe serum concentration of Maraviroc can be decreased when it is combined with Siltuximab.Approved, Investigational
MebendazoleThe serum concentration of Mebendazole can be decreased when it is combined with Siltuximab.Approved, Vet Approved
Medical CannabisThe serum concentration of Medical Cannabis can be decreased when it is combined with Siltuximab.Experimental, Investigational
Medroxyprogesterone acetateThe serum concentration of Medroxyprogesterone acetate can be decreased when it is combined with Siltuximab.Approved, Investigational
MefloquineThe serum concentration of Mefloquine can be decreased when it is combined with Siltuximab.Approved, Investigational
MeloxicamThe serum concentration of Meloxicam can be decreased when it is combined with Siltuximab.Approved, Vet Approved
MentholThe serum concentration of Menthol can be decreased when it is combined with Siltuximab.Approved
MethadoneThe serum concentration of Methadone can be decreased when it is combined with Siltuximab.Approved
MethaqualoneThe serum concentration of Methaqualone can be decreased when it is combined with Siltuximab.Illicit, Withdrawn
MethimazoleThe risk or severity of adverse effects can be increased when Siltuximab is combined with Methimazole.Approved
MethoxsalenThe serum concentration of Methoxsalen can be decreased when it is combined with Siltuximab.Approved
MethoxyfluraneThe serum concentration of Methoxyflurane can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
MethylprednisoloneThe serum concentration of Methylprednisolone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
MethyltestosteroneThe serum concentration of Methyltestosterone can be decreased when it is combined with Siltuximab.Approved
MetildigoxinMetildigoxin may decrease the cardiotoxic activities of Siltuximab.Experimental
MetronidazoleThe serum concentration of Metronidazole can be decreased when it is combined with Siltuximab.Approved
MexiletineThe serum concentration of Mexiletine can be decreased when it is combined with Siltuximab.Approved, Investigational
MianserinThe serum concentration of Mianserin can be decreased when it is combined with Siltuximab.Approved, Investigational
MibefradilThe serum concentration of Mibefradil can be decreased when it is combined with Siltuximab.Investigational, Withdrawn
MiconazoleThe serum concentration of Miconazole can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
MidazolamThe serum concentration of Midazolam can be decreased when it is combined with Siltuximab.Approved, Illicit
MidecamycinThe serum concentration of Midecamycin can be decreased when it is combined with Siltuximab.Approved
MidostaurinThe serum concentration of Midostaurin can be decreased when it is combined with Siltuximab.Approved, Investigational
MifepristoneThe serum concentration of Mifepristone can be decreased when it is combined with Siltuximab.Approved, Investigational
MirabegronThe serum concentration of Mirabegron can be decreased when it is combined with Siltuximab.Approved
MirtazapineThe serum concentration of Mirtazapine can be decreased when it is combined with Siltuximab.Approved
ModafinilThe serum concentration of Modafinil can be decreased when it is combined with Siltuximab.Approved, Investigational
MontelukastThe serum concentration of Montelukast can be decreased when it is combined with Siltuximab.Approved
MorphineThe serum concentration of Morphine can be decreased when it is combined with Siltuximab.Approved, Investigational
Mycophenolate mofetilThe serum concentration of Mycophenolate mofetil can be decreased when it is combined with Siltuximab.Approved, Investigational
NabiximolsThe serum concentration of Nabiximols can be decreased when it is combined with Siltuximab.Approved, Investigational
NaftopidilThe serum concentration of Naftopidil can be decreased when it is combined with Siltuximab.Investigational
NaloxegolThe serum concentration of Naloxegol can be decreased when it is combined with Siltuximab.Approved
NaloxoneThe serum concentration of Naloxone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
NatalizumabThe risk or severity of adverse effects can be increased when Siltuximab is combined with Natalizumab.Approved, Investigational
NateglinideThe serum concentration of Nateglinide can be decreased when it is combined with Siltuximab.Approved, Investigational
NefazodoneThe serum concentration of Nefazodone can be decreased when it is combined with Siltuximab.Approved, Withdrawn
NelfinavirThe serum concentration of Nelfinavir can be decreased when it is combined with Siltuximab.Approved
NeratinibThe serum concentration of Neratinib can be decreased when it is combined with Siltuximab.Approved, Investigational
NevirapineThe serum concentration of Nevirapine can be decreased when it is combined with Siltuximab.Approved
NicardipineThe serum concentration of Nicardipine can be decreased when it is combined with Siltuximab.Approved, Investigational
NicotineThe serum concentration of Nicotine can be decreased when it is combined with Siltuximab.Approved
NifedipineThe serum concentration of Nifedipine can be decreased when it is combined with Siltuximab.Approved
NiguldipineThe serum concentration of Niguldipine can be decreased when it is combined with Siltuximab.Experimental
NilotinibThe serum concentration of Nilotinib can be decreased when it is combined with Siltuximab.Approved, Investigational
NiludipineThe serum concentration of Niludipine can be decreased when it is combined with Siltuximab.Experimental
NilvadipineThe serum concentration of Nilvadipine can be decreased when it is combined with Siltuximab.Approved, Investigational
NimesulideThe serum concentration of Nimesulide can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
NimodipineThe serum concentration of Nimodipine can be decreased when it is combined with Siltuximab.Approved, Investigational
NisoldipineThe serum concentration of Nisoldipine can be decreased when it is combined with Siltuximab.Approved
NitrazepamThe serum concentration of Nitrazepam can be decreased when it is combined with Siltuximab.Approved
NitrendipineThe serum concentration of Nitrendipine can be decreased when it is combined with Siltuximab.Approved, Investigational
NorethisteroneThe serum concentration of Norethisterone can be decreased when it is combined with Siltuximab.Approved
NorgestrelThe serum concentration of Norgestrel can be decreased when it is combined with Siltuximab.Approved
NortriptylineThe serum concentration of Nortriptyline can be decreased when it is combined with Siltuximab.Approved
NylidrinThe serum concentration of Nylidrin can be decreased when it is combined with Siltuximab.Approved
OcrelizumabOcrelizumab may increase the immunosuppressive activities of Siltuximab.Approved, Investigational
OdanacatibThe serum concentration of Odanacatib can be decreased when it is combined with Siltuximab.Investigational
OlaparibThe serum concentration of Olaparib can be decreased when it is combined with Siltuximab.Approved
OleandrinOleandrin may decrease the cardiotoxic activities of Siltuximab.Experimental, Investigational
OlopatadineThe serum concentration of Olopatadine can be decreased when it is combined with Siltuximab.Approved
OmalizumabThe risk or severity of adverse effects can be increased when Omalizumab is combined with Siltuximab.Approved, Investigational
OmeprazoleThe serum concentration of Omeprazole can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
OndansetronThe serum concentration of Ondansetron can be decreased when it is combined with Siltuximab.Approved
OpiumThe serum concentration of Opium can be decreased when it is combined with Siltuximab.Approved, Illicit
OrphenadrineThe serum concentration of Orphenadrine can be decreased when it is combined with Siltuximab.Approved
OspemifeneThe serum concentration of Ospemifene can be decreased when it is combined with Siltuximab.Approved, Investigational
OtiloniumThe serum concentration of Otilonium can be decreased when it is combined with Siltuximab.Experimental, Investigational
OuabainOuabain may decrease the cardiotoxic activities of Siltuximab.Approved
OxazepamThe serum concentration of Oxazepam can be decreased when it is combined with Siltuximab.Approved
OxybutyninThe serum concentration of Oxybutynin can be decreased when it is combined with Siltuximab.Approved, Investigational
OxycodoneThe serum concentration of Oxycodone can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
OxymorphoneThe serum concentration of Oxymorphone can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
PaclitaxelThe serum concentration of Paclitaxel can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PalbociclibThe serum concentration of Palbociclib can be decreased when it is combined with Siltuximab.Approved, Investigational
PalonosetronThe serum concentration of Palonosetron can be decreased when it is combined with Siltuximab.Approved, Investigational
PanobinostatThe serum concentration of Panobinostat can be decreased when it is combined with Siltuximab.Approved, Investigational
PantoprazoleThe serum concentration of Pantoprazole can be decreased when it is combined with Siltuximab.Approved
ParamethadioneThe serum concentration of Paramethadione can be decreased when it is combined with Siltuximab.Approved
ParamethasoneThe serum concentration of Paramethasone can be decreased when it is combined with Siltuximab.Approved
ParecoxibThe serum concentration of Parecoxib can be decreased when it is combined with Siltuximab.Approved
ParicalcitolThe serum concentration of Paricalcitol can be decreased when it is combined with Siltuximab.Approved, Investigational
ParitaprevirThe serum concentration of Paritaprevir can be decreased when it is combined with Siltuximab.Approved, Investigational
PazopanibThe serum concentration of Pazopanib can be decreased when it is combined with Siltuximab.Approved
PegaspargaseThe risk or severity of adverse effects can be increased when Siltuximab is combined with Pegaspargase.Approved, Investigational
Peginterferon alfa-2aThe risk or severity of adverse effects can be increased when Siltuximab is combined with Peginterferon alfa-2a.Approved, Investigational
Peginterferon alfa-2bThe risk or severity of adverse effects can be increased when Siltuximab is combined with Peginterferon alfa-2b.Approved
PenfluridolThe serum concentration of Penfluridol can be decreased when it is combined with Siltuximab.Experimental
PentamidineThe serum concentration of Pentamidine can be decreased when it is combined with Siltuximab.Approved, Investigational
PerampanelThe serum concentration of Perampanel can be decreased when it is combined with Siltuximab.Approved
PergolideThe serum concentration of Pergolide can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved, Withdrawn
PerhexilineThe serum concentration of Perhexiline can be decreased when it is combined with Siltuximab.Approved, Investigational
PermethrinThe serum concentration of Permethrin can be decreased when it is combined with Siltuximab.Approved, Investigational
PerospironeThe serum concentration of Perospirone can be decreased when it is combined with Siltuximab.Approved
PerphenazineThe serum concentration of Perphenazine can be decreased when it is combined with Siltuximab.Approved
PeruvosidePeruvoside may decrease the cardiotoxic activities of Siltuximab.Experimental
PethidineThe serum concentration of Pethidine can be decreased when it is combined with Siltuximab.Approved
PhenacetinThe serum concentration of Phenacetin can be decreased when it is combined with Siltuximab.Withdrawn
PhenoxybenzamineThe serum concentration of Phenoxybenzamine can be decreased when it is combined with Siltuximab.Approved
PhenprocoumonThe serum concentration of Phenprocoumon can be decreased when it is combined with Siltuximab.Approved, Investigational
PhenytoinThe serum concentration of Phenytoin can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PilocarpineThe serum concentration of Pilocarpine can be decreased when it is combined with Siltuximab.Approved, Investigational
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Siltuximab.Approved, Investigational
PimozideThe serum concentration of Pimozide can be decreased when it is combined with Siltuximab.Approved
PinacidilThe serum concentration of Pinacidil can be decreased when it is combined with Siltuximab.Approved
PinaveriumThe serum concentration of Pinaverium can be decreased when it is combined with Siltuximab.Approved
PioglitazoneThe serum concentration of Pioglitazone can be decreased when it is combined with Siltuximab.Approved, Investigational
PiperaquineThe serum concentration of Piperaquine can be decreased when it is combined with Siltuximab.Approved, Investigational
PipotiazineThe serum concentration of Pipotiazine can be decreased when it is combined with Siltuximab.Approved, Investigational
PitolisantThe serum concentration of Pitolisant can be decreased when it is combined with Siltuximab.Approved, Investigational
PodofiloxThe serum concentration of Podofilox can be decreased when it is combined with Siltuximab.Approved
PomalidomideThe serum concentration of Pomalidomide can be decreased when it is combined with Siltuximab.Approved
PonatinibThe serum concentration of Ponatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
PosaconazoleThe serum concentration of Posaconazole can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
PrasteroneThe serum concentration of Prasterone can be decreased when it is combined with Siltuximab.Approved, Investigational, Nutraceutical
PrasugrelThe serum concentration of Prasugrel can be decreased when it is combined with Siltuximab.Approved
PravastatinThe serum concentration of Pravastatin can be decreased when it is combined with Siltuximab.Approved
PrazepamThe serum concentration of Prazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
PraziquantelThe serum concentration of Praziquantel can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
PrednisoloneThe serum concentration of Prednisolone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PrednisoneThe serum concentration of Prednisone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PregabalinThe serum concentration of Pregabalin can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
PrenylamineThe serum concentration of Prenylamine can be decreased when it is combined with Siltuximab.Withdrawn
PrimaquineThe serum concentration of Primaquine can be decreased when it is combined with Siltuximab.Approved
ProchlorperazineThe serum concentration of Prochlorperazine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ProgesteroneThe serum concentration of Progesterone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ProguanilThe serum concentration of Proguanil can be decreased when it is combined with Siltuximab.Approved
PromazineThe serum concentration of Promazine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PropafenoneThe serum concentration of Propafenone can be decreased when it is combined with Siltuximab.Approved
PropiverineThe serum concentration of Propiverine can be decreased when it is combined with Siltuximab.Approved, Investigational
PropofolThe serum concentration of Propofol can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
PropranololThe serum concentration of Propranolol can be decreased when it is combined with Siltuximab.Approved, Investigational
ProscillaridinProscillaridin may decrease the cardiotoxic activities of Siltuximab.Experimental
PyrazinamideThe serum concentration of Pyrazinamide can be decreased when it is combined with Siltuximab.Approved, Investigational
QuazepamThe serum concentration of Quazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
QuetiapineThe serum concentration of Quetiapine can be decreased when it is combined with Siltuximab.Approved
QuinacrineThe serum concentration of Quinacrine can be decreased when it is combined with Siltuximab.Approved, Investigational
QuinidineThe serum concentration of Quinidine can be decreased when it is combined with Siltuximab.Approved, Investigational
QuinineThe serum concentration of Quinine can be decreased when it is combined with Siltuximab.Approved
RabeprazoleThe serum concentration of Rabeprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
Rabies virus inactivated antigen, AThe risk or severity of adverse effects can be increased when Siltuximab is combined with Rabies virus inactivated antigen, A.Approved, Investigational
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Siltuximab.Approved, Investigational
RaloxifeneThe serum concentration of Raloxifene can be decreased when it is combined with Siltuximab.Approved, Investigational
RamelteonThe serum concentration of Ramelteon can be decreased when it is combined with Siltuximab.Approved, Investigational
RanolazineThe serum concentration of Ranolazine can be decreased when it is combined with Siltuximab.Approved, Investigational
ReboxetineThe serum concentration of Reboxetine can be decreased when it is combined with Siltuximab.Approved, Investigational
RegorafenibThe serum concentration of Regorafenib can be decreased when it is combined with Siltuximab.Approved
RepaglinideThe serum concentration of Repaglinide can be decreased when it is combined with Siltuximab.Approved, Investigational
RetapamulinThe serum concentration of Retapamulin can be decreased when it is combined with Siltuximab.Approved
RifabutinThe serum concentration of Rifabutin can be decreased when it is combined with Siltuximab.Approved, Investigational
RifampicinThe serum concentration of Rifampicin can be decreased when it is combined with Siltuximab.Approved
RilpivirineThe serum concentration of Rilpivirine can be decreased when it is combined with Siltuximab.Approved
RimonabantThe serum concentration of Rimonabant can be decreased when it is combined with Siltuximab.Approved, Investigational
RindopepimutThe risk or severity of adverse effects can be increased when Siltuximab is combined with Rindopepimut.Investigational
RiociguatThe serum concentration of Riociguat can be decreased when it is combined with Siltuximab.Approved
RisperidoneThe serum concentration of Risperidone can be decreased when it is combined with Siltuximab.Approved, Investigational
RitonavirThe serum concentration of Ritonavir can be decreased when it is combined with Siltuximab.Approved, Investigational
RivaroxabanThe serum concentration of Rivaroxaban can be decreased when it is combined with Siltuximab.Approved
RofecoxibThe serum concentration of Rofecoxib can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
RoflumilastRoflumilast may increase the immunosuppressive activities of Siltuximab.Approved
RolapitantThe serum concentration of Rolapitant can be decreased when it is combined with Siltuximab.Approved, Investigational
RomidepsinThe serum concentration of Romidepsin can be decreased when it is combined with Siltuximab.Approved, Investigational
RopiniroleThe serum concentration of Ropinirole can be decreased when it is combined with Siltuximab.Approved, Investigational
RopivacaineThe serum concentration of Ropivacaine can be decreased when it is combined with Siltuximab.Approved
RosiglitazoneThe serum concentration of Rosiglitazone can be decreased when it is combined with Siltuximab.Approved, Investigational
RosuvastatinThe serum concentration of Rosuvastatin can be decreased when it is combined with Siltuximab.Approved
Rotavirus VaccineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Rotavirus Vaccine.Approved
RotigotineThe serum concentration of Rotigotine can be decreased when it is combined with Siltuximab.Approved
RoxithromycinThe serum concentration of Roxithromycin can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
Rubella virus vaccineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Rubella virus vaccine.Approved, Investigational
RucaparibThe serum concentration of Rucaparib can be decreased when it is combined with Siltuximab.Approved, Investigational
RupatadineThe serum concentration of Rupatadine can be decreased when it is combined with Siltuximab.Approved
RuxolitinibThe serum concentration of Ruxolitinib can be decreased when it is combined with Siltuximab.Approved
SafinamideThe serum concentration of Safinamide can be decreased when it is combined with Siltuximab.Approved, Investigational
SalmeterolThe serum concentration of Salmeterol can be decreased when it is combined with Siltuximab.Approved
Salmonella typhi ty2 vi polysaccharide antigenThe risk or severity of adverse effects can be increased when Siltuximab is combined with Salmonella typhi ty2 vi polysaccharide antigen.Approved
Salmonella typhi Ty21a live antigenThe risk or severity of adverse effects can be increased when Siltuximab is combined with Salmonella typhi ty21a live antigen.Approved
SaquinavirThe serum concentration of Saquinavir can be decreased when it is combined with Siltuximab.Approved, Investigational
SaxagliptinThe serum concentration of Saxagliptin can be decreased when it is combined with Siltuximab.Approved
SelegilineThe serum concentration of Selegiline can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
SeletracetamThe serum concentration of Seletracetam can be decreased when it is combined with Siltuximab.Investigational
SelexipagThe serum concentration of Selexipag can be decreased when it is combined with Siltuximab.Approved
SeratrodastThe serum concentration of Seratrodast can be decreased when it is combined with Siltuximab.Approved
SertindoleThe serum concentration of Sertindole can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
SertralineThe serum concentration of Sertraline can be decreased when it is combined with Siltuximab.Approved
SevofluraneThe serum concentration of Sevoflurane can be decreased when it is combined with Siltuximab.Approved, Vet Approved
SibutramineThe serum concentration of Sibutramine can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Withdrawn
SildenafilThe serum concentration of Sildenafil can be decreased when it is combined with Siltuximab.Approved, Investigational
SilodosinThe serum concentration of Silodosin can be decreased when it is combined with Siltuximab.Approved
SimvastatinThe serum concentration of Simvastatin can be decreased when it is combined with Siltuximab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Siltuximab.Approved, Investigational
SirolimusThe serum concentration of Sirolimus can be decreased when it is combined with Siltuximab.Approved, Investigational
SitagliptinThe serum concentration of Sitagliptin can be decreased when it is combined with Siltuximab.Approved, Investigational
SolifenacinThe serum concentration of Solifenacin can be decreased when it is combined with Siltuximab.Approved
SonidegibThe serum concentration of Sonidegib can be decreased when it is combined with Siltuximab.Approved, Investigational
SorafenibThe serum concentration of Sorafenib can be decreased when it is combined with Siltuximab.Approved, Investigational
SpiramycinThe serum concentration of Spiramycin can be decreased when it is combined with Siltuximab.Approved
SRP 299The risk or severity of adverse effects can be increased when Siltuximab is combined with SRP 299.Investigational
SufentanilThe serum concentration of Sufentanil can be decreased when it is combined with Siltuximab.Approved, Investigational
SulfadiazineThe serum concentration of Sulfadiazine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
SulfamethoxazoleThe serum concentration of Sulfamethoxazole can be decreased when it is combined with Siltuximab.Approved
SulfasalazineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Sulfasalazine.Approved
SulfinpyrazoneThe serum concentration of Sulfinpyrazone can be decreased when it is combined with Siltuximab.Approved
SunitinibThe serum concentration of Sunitinib can be decreased when it is combined with Siltuximab.Approved, Investigational
Synthetic Conjugated Estrogens, AThe serum concentration of Synthetic Conjugated Estrogens, A can be decreased when it is combined with Siltuximab.Approved
Synthetic Conjugated Estrogens, BThe serum concentration of Synthetic Conjugated Estrogens, B can be decreased when it is combined with Siltuximab.Approved
TacrolimusTacrolimus may increase the immunosuppressive activities of Siltuximab.Approved, Investigational
TadalafilThe serum concentration of Tadalafil can be decreased when it is combined with Siltuximab.Approved, Investigational
TamoxifenThe serum concentration of Tamoxifen can be decreased when it is combined with Siltuximab.Approved
TamsulosinThe serum concentration of Tamsulosin can be decreased when it is combined with Siltuximab.Approved, Investigational
TasosartanThe serum concentration of Tasosartan can be decreased when it is combined with Siltuximab.Approved
Taurochenodeoxycholic acidThe serum concentration of Taurochenodeoxycholic acid can be decreased when it is combined with Siltuximab.Experimental
TecemotideThe risk or severity of adverse effects can be increased when Siltuximab is combined with Tecemotide.Investigational
TelaprevirThe serum concentration of Telaprevir can be decreased when it is combined with Siltuximab.Approved, Withdrawn
TelithromycinThe serum concentration of Telithromycin can be decreased when it is combined with Siltuximab.Approved
TemazepamThe serum concentration of Temazepam can be decreased when it is combined with Siltuximab.Approved, Investigational
TemsirolimusThe serum concentration of Temsirolimus can be decreased when it is combined with Siltuximab.Approved
TeniposideThe serum concentration of Teniposide can be decreased when it is combined with Siltuximab.Approved
TerbinafineThe serum concentration of Terbinafine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
TerfenadineThe serum concentration of Terfenadine can be decreased when it is combined with Siltuximab.Approved, Withdrawn
TerodilineThe serum concentration of Terodiline can be decreased when it is combined with Siltuximab.Experimental
TesmilifeneThe serum concentration of Tesmilifene can be decreased when it is combined with Siltuximab.Investigational
TestosteroneThe serum concentration of Testosterone can be decreased when it is combined with Siltuximab.Approved, Investigational
Testosterone cypionateThe serum concentration of Testosterone cypionate can be decreased when it is combined with Siltuximab.Approved
Testosterone enanthateThe serum concentration of Testosterone enanthate can be decreased when it is combined with Siltuximab.Approved
Testosterone propionateThe serum concentration of Testosterone propionate can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved, Withdrawn
Testosterone undecanoateThe serum concentration of Testosterone undecanoate can be decreased when it is combined with Siltuximab.Approved, Investigational
TetracyclineThe serum concentration of Tetracycline can be decreased when it is combined with Siltuximab.Approved, Vet Approved
TetrahydropalmatineThe serum concentration of Tetrahydropalmatine can be decreased when it is combined with Siltuximab.Investigational
TetrandrineThe serum concentration of Tetrandrine can be decreased when it is combined with Siltuximab.Experimental
TezacaftorThe serum concentration of Tezacaftor can be decreased when it is combined with Siltuximab.Approved, Investigational
TG4010The risk or severity of adverse effects can be increased when Siltuximab is combined with TG4010.Investigational
TheophyllineThe serum concentration of Theophylline can be decreased when it is combined with Siltuximab.Approved
ThiotepaThe serum concentration of Thiotepa can be decreased when it is combined with Siltuximab.Approved, Investigational
TiagabineThe serum concentration of Tiagabine can be decreased when it is combined with Siltuximab.Approved, Investigational
TicagrelorThe serum concentration of Ticagrelor can be decreased when it is combined with Siltuximab.Approved
TiclopidineThe serum concentration of Ticlopidine can be decreased when it is combined with Siltuximab.Approved
TinidazoleThe serum concentration of Tinidazole can be decreased when it is combined with Siltuximab.Approved, Investigational
TiotropiumThe serum concentration of Tiotropium can be decreased when it is combined with Siltuximab.Approved
TipranavirThe serum concentration of Tipranavir can be decreased when it is combined with Siltuximab.Approved, Investigational
TocofersolanThe serum concentration of Tocofersolan can be decreased when it is combined with Siltuximab.Approved
TocopherolThe serum concentration of Tocopherol can be decreased when it is combined with Siltuximab.Approved, Investigational
TofacitinibSiltuximab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
Tolfenamic AcidThe serum concentration of Tolfenamic Acid can be decreased when it is combined with Siltuximab.Approved, Investigational
TolterodineThe serum concentration of Tolterodine can be decreased when it is combined with Siltuximab.Approved, Investigational
TolvaptanThe serum concentration of Tolvaptan can be decreased when it is combined with Siltuximab.Approved
ToremifeneThe serum concentration of Toremifene can be decreased when it is combined with Siltuximab.Approved, Investigational
TrabectedinThe serum concentration of Trabectedin can be decreased when it is combined with Siltuximab.Approved, Investigational
TramadolThe serum concentration of Tramadol can be decreased when it is combined with Siltuximab.Approved, Investigational
TranilastThe serum concentration of Tranilast can be decreased when it is combined with Siltuximab.Approved, Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Siltuximab.Approved, Investigational
Trastuzumab emtansineThe serum concentration of Trastuzumab emtansine can be decreased when it is combined with Siltuximab.Approved, Investigational
TrazodoneThe serum concentration of Trazodone can be decreased when it is combined with Siltuximab.Approved, Investigational
TretinoinThe serum concentration of Tretinoin can be decreased when it is combined with Siltuximab.Approved, Investigational, Nutraceutical
TriamcinoloneThe serum concentration of Triamcinolone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
TriazolamThe serum concentration of Triazolam can be decreased when it is combined with Siltuximab.Approved, Investigational
TrimebutineThe serum concentration of Trimebutine can be decreased when it is combined with Siltuximab.Approved
TrimethadioneThe serum concentration of Trimethadione can be decreased when it is combined with Siltuximab.Approved
TrimethoprimThe serum concentration of Trimethoprim can be decreased when it is combined with Siltuximab.Approved, Vet Approved
TrimipramineThe serum concentration of Trimipramine can be decreased when it is combined with Siltuximab.Approved
TroglitazoneThe serum concentration of Troglitazone can be decreased when it is combined with Siltuximab.Investigational, Withdrawn
TroleandomycinThe serum concentration of Troleandomycin can be decreased when it is combined with Siltuximab.Approved
Typhoid VaccineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Typhoid Vaccine.Approved
UdenafilThe serum concentration of Udenafil can be decreased when it is combined with Siltuximab.Approved, Investigational
UlipristalThe serum concentration of Ulipristal can be decreased when it is combined with Siltuximab.Approved
ValbenazineThe serum concentration of Valbenazine can be decreased when it is combined with Siltuximab.Approved, Investigational
ValdecoxibThe serum concentration of Valdecoxib can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
Valproic AcidThe serum concentration of Valproic Acid can be decreased when it is combined with Siltuximab.Approved, Investigational
VandetanibThe serum concentration of Vandetanib can be decreased when it is combined with Siltuximab.Approved
VanoxerineThe serum concentration of Vanoxerine can be decreased when it is combined with Siltuximab.Investigational
VardenafilThe serum concentration of Vardenafil can be decreased when it is combined with Siltuximab.Approved
Varicella Zoster Vaccine (Live/Attenuated)The risk or severity of adverse effects can be increased when Siltuximab is combined with Varicella Zoster Vaccine (Live/Attenuated).Approved
VelpatasvirThe serum concentration of Velpatasvir can be decreased when it is combined with Siltuximab.Approved, Investigational
VemurafenibThe serum concentration of Vemurafenib can be decreased when it is combined with Siltuximab.Approved
VenetoclaxThe serum concentration of Venetoclax can be decreased when it is combined with Siltuximab.Approved, Investigational
VenlafaxineThe serum concentration of Venlafaxine can be decreased when it is combined with Siltuximab.Approved
VerapamilThe serum concentration of Verapamil can be decreased when it is combined with Siltuximab.Approved
VicrivirocThe serum concentration of Vicriviroc can be decreased when it is combined with Siltuximab.Investigational
VilanterolThe serum concentration of Vilanterol can be decreased when it is combined with Siltuximab.Approved
VilazodoneThe serum concentration of Vilazodone can be decreased when it is combined with Siltuximab.Approved
VinblastineThe serum concentration of Vinblastine can be decreased when it is combined with Siltuximab.Approved
VincristineThe serum concentration of Vincristine can be decreased when it is combined with Siltuximab.Approved, Investigational
VindesineThe serum concentration of Vindesine can be decreased when it is combined with Siltuximab.Approved, Investigational
VinflunineThe serum concentration of Vinflunine can be decreased when it is combined with Siltuximab.Approved, Investigational
VinorelbineThe serum concentration of Vinorelbine can be decreased when it is combined with Siltuximab.Approved, Investigational
VinpocetineThe serum concentration of Vinpocetine can be decreased when it is combined with Siltuximab.Investigational
VismodegibThe serum concentration of Vismodegib can be decreased when it is combined with Siltuximab.Approved, Investigational
VoriconazoleThe serum concentration of Voriconazole can be decreased when it is combined with Siltuximab.Approved, Investigational
VortioxetineThe serum concentration of Vortioxetine can be decreased when it is combined with Siltuximab.Approved, Investigational
VoxilaprevirThe serum concentration of Voxilaprevir can be decreased when it is combined with Siltuximab.Approved, Investigational
WarfarinThe serum concentration of Warfarin can be decreased when it is combined with Siltuximab.Approved
WIN 55212-2The serum concentration of WIN 55212-2 can be decreased when it is combined with Siltuximab.Experimental
Yellow Fever VaccineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Yellow Fever Vaccine.Approved, Investigational
YohimbineThe serum concentration of Yohimbine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
ZafirlukastThe serum concentration of Zafirlukast can be decreased when it is combined with Siltuximab.Approved, Investigational
ZalcitabineThe serum concentration of Zalcitabine can be decreased when it is combined with Siltuximab.Approved, Investigational
ZaleplonThe serum concentration of Zaleplon can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
ZiconotideThe serum concentration of Ziconotide can be decreased when it is combined with Siltuximab.Approved
ZidovudineThe serum concentration of Zidovudine can be decreased when it is combined with Siltuximab.Approved
ZileutonThe serum concentration of Zileuton can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
ZiprasidoneThe serum concentration of Ziprasidone can be decreased when it is combined with Siltuximab.Approved
ZolpidemThe serum concentration of Zolpidem can be decreased when it is combined with Siltuximab.Approved
ZomepiracThe serum concentration of Zomepirac can be decreased when it is combined with Siltuximab.Withdrawn
ZonisamideThe serum concentration of Zonisamide can be decreased when it is combined with Siltuximab.Approved, Investigational
ZopicloneThe serum concentration of Zopiclone can be decreased when it is combined with Siltuximab.Approved
ZotepineThe serum concentration of Zotepine can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
Food Interactions
Not Available

References

General References
  1. Puchalski T, Prabhakar U, Jiao Q, Berns B, Davis HM: Pharmacokinetic and pharmacodynamic modeling of an anti-interleukin-6 chimeric monoclonal antibody (siltuximab) in patients with metastatic renal cell carcinoma. Clin Cancer Res. 2010 Mar 1;16(5):1652-61. doi: 10.1158/1078-0432.CCR-09-2581. Epub 2010 Feb 23. [PubMed:20179212]
  2. Deisseroth A, Ko CW, Nie L, Zirkelbach JF, Zhao L, Bullock J, Mehrotra N, Del Valle P, Saber H, Sheth C, Gehrke B, Justice R, Farrell A, Pazdur R: FDA approval: siltuximab for the treatment of patients with multicentric Castleman disease. Clin Cancer Res. 2015 Mar 1;21(5):950-4. doi: 10.1158/1078-0432.CCR-14-1678. Epub 2015 Jan 19. [PubMed:25601959]
  3. Liu YC, Stone K, van Rhee F: Siltuximab for multicentric Castleman disease. Expert Rev Hematol. 2014 Oct;7(5):545-57. doi: 10.1586/17474086.2014.946402. Epub 2014 Aug 9. [PubMed:25110138]
External Links
KEGG Drug
D09669
PubChem Substance
347910394
ChEMBL
CHEMBL1743070
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Siltuximab
ATC Codes
L04AC11 — Siltuximab
AHFS Codes
  • 92:44.00 — Immunosuppressive Agents
FDA label
Download (326 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedBasic ScienceDiabetes, Diabetes Mellitus Type 11
0WithdrawnTreatmentAgnogenic Myeloid Metaplasia / Polycythemia Vera (PV) / Primary Myelofibrosis / Thrombocytopenias1
1CompletedTreatmentGiant Lymph Node Hyperplasia / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentHealthy Volunteers1
1CompletedTreatmentMonoclonal Gammopathy of Undetermined Significance (MGUS) / Multiple Myeloma (MM) / Plasma Cell Neoplasms1
1CompletedTreatmentProstatic Neoplasms1
1TerminatedTreatmentMultiple Myeloma (MM)1
1, 2CompletedTreatmentNeoplasms, Colorectal / Neoplasms, Head and Neck / Neoplasms, Lung / Neoplasms, Ovarian / Neoplasms, Pancreatic1
1, 2CompletedTreatmentPlasma Cell Myeloma1
1, 2CompletedTreatmentRenal Cell Adenocarcinoma1
1, 2RecruitingTreatmentPsychotic Disorder NOS / Schizophrenic Disorders1
2Active Not RecruitingTreatmentHigh-risk Smoldering Multiple Myeloma1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentMulticentric Castleman's Disease2
2CompletedTreatmentMultiple Myeloma (MM)2
2CompletedTreatmentProstate Cancer1
2RecruitingTreatmentAL Amyloidosis / Multiple Myeloma (MM)1
2TerminatedTreatmentMyelodysplastic Syndrome1
2TerminatedTreatmentProstate Cancer1
2WithdrawnTreatmentRenal Cancers1
3WithdrawnTreatmentMultiple Myeloma (MM)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionIntravenous100 mg/1
Injection, powder, lyophilized, for solutionIntravenous400 mg/1
Powder, for solutionIntravenous100 mg
Powder, for solutionIntravenous400 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US7612182No2007-08-012027-08-01Us

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
Antibody
General Function
Interleukin-6 receptor binding
Specific Function
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Inv...
Gene Name
IL6
Uniprot ID
P05231
Uniprot Name
Interleukin-6
Molecular Weight
23717.965 Da
References
  1. van Zaanen HC, Koopmans RP, Aarden LA, Rensink HJ, Stouthard JM, Warnaar SO, Lokhorst HM, van Oers MH: Endogenous interleukin 6 production in multiple myeloma patients treated with chimeric monoclonal anti-IL6 antibodies indicates the existence of a positive feed-back loop. J Clin Invest. 1996 Sep 15;98(6):1441-8. [PubMed:8823310]

Drug created on March 16, 2015 13:35 / Updated on August 15, 2018 09:55