Identification
NameSiltuximab
Accession NumberDB09036
TypeBiotech
GroupsApproved
Description

Siltuximab is a chimeric (human-mouse) monoclonal immunoglobulin G1-kappa antibody produced in a Chinese hamster ovary (CHO) cell line by recombinant DNA technology. Siltuximab prevents the binding of IL-6 to soluble and membrane-bound IL-6 receptors by forming high affinity complexes with human interleukin-6 (IL-6). Its use is indicated for the treatment of adult patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. MCD is a rare blood disorder caused by dysregulated IL-6 production, proliferation of lymphocytes, and subsequent enlargement of the lymph nodes. It is administered as a 1 hour intravenous infusion every 3 weeks.

Protein structureDb09036
Related Articles
Protein chemical formulaC6450H9932N1688O2016S50
Protein average weight145000.0 Da
Sequences
>Heavy Chain Sequence
EVQLVESGGKLLKPGGSLKLSCAASGFTFSSFAMSWFRQSPEKRLEWVAEISSGGSYTYY
PDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGLWGYYALDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain Sequence
QIVLIQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATYYCQQWSGYPYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
SynonymsNot Available
External IDs CLLB8 / CNTO 328 / CNTO-328 / CNTO328
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SylvantInjection, powder, lyophilized, for solution100 mg/1IntravenousJanssen Biotech, Inc.2014-04-23Not applicableUs
SylvantPowder, for solution400 mgIntravenousJanssen Pharmaceuticals2015-03-03Not applicableCanada
SylvantInjection, powder, lyophilized, for solution400 mg/1IntravenousJanssen Biotech, Inc.2014-04-01Not applicableUs
SylvantPowder, for solution100 mgIntravenousJanssen Pharmaceuticals2015-03-03Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNIIT4H8FMA7IM
CAS number541502-14-1
Pharmacology
Indication

Siltuximab is indicated for the treatment of patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. Siltuximab did not bind to virally produced IL-6 in a nonclinical study and was therefore not studied in patients with MCD who are HIV or HHV-8 positive.

Structured Indications
Pharmacodynamics

Siltuximab-neutralized antibody-IL-6 complexes interfere with current immunological-based IL-6 quantification methods, therefore measurement of serum or plasma IL-6 concentrations should not be used as a pharmacodynamic marker during treatment. As well, cytochrome P450 enzymes in the liver are down regulated by infection and inflammation stimuli, which includes cytokines such as IL-6. By preventing IL-6 signalling through treatment with siltuximab, CYP450 activity may be increased leading to faster metabolism of drugs that are CYP450 substrates.

Mechanism of action

Siltuximab complexes with human IL-6 and prevents binding to soluble and membrane-bound IL-6 receptors, thereby inhibiting the proliferation of lymphocytes.

TargetKindPharmacological actionActionsOrganismUniProt ID
Interleukin-6Proteinyes
antagonist
antibody
HumanP05231 details
Related Articles
AbsorptionNot Available
Volume of distribution

Based on population pharmacokinetic analysis, the central volume of distribution in a male subject with body weight of 70 kg is 4.5 L.

Protein bindingNot Available
Metabolism

As siltuximab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of eliminationNot Available
Half life

The mean terminal half life after the first intravenous infusion of 11 mg/kg is 20.6 days.

Clearance

Body weight was identified as the only statistically significant covariate of siltuximab clearance, therefore body weight based dosing is appropriate. Based on population pharmacokinetic analysis, the clearance of situximab in patients is 0.23 L/day.

Toxicity

The most common side effects that occurred during siltuximab treatment were pruritis, increased weight, rash, hyperuricemia, and upper respiratory tract infection. Siltuximab should not be administered to patients with severe infections as it may mask signs and symptoms of acute inflammation including suppression of fever and acute phase reactants such as C-reactive protein (CRP). Gastrointestinal perforation has been reported in clinical trials, therefore use with caution in patients who may be at increased risk for GI perforation.

Affected organismsNot Available
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
AbirateroneThe serum concentration of Abiraterone can be decreased when it is combined with Siltuximab.Approved
AcenocoumarolThe serum concentration of Acenocoumarol can be decreased when it is combined with Siltuximab.Approved
AcetaminophenThe serum concentration of Acetaminophen can be decreased when it is combined with Siltuximab.Approved
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Siltuximab.Approved
AdinazolamThe serum concentration of Adinazolam can be decreased when it is combined with Siltuximab.Approved
AlbendazoleThe serum concentration of Albendazole can be decreased when it is combined with Siltuximab.Approved, Vet Approved
AlclometasoneThe serum concentration of Alclometasone can be decreased when it is combined with Siltuximab.Approved
AlfentanilThe serum concentration of Alfentanil can be decreased when it is combined with Siltuximab.Approved, Illicit
AlfuzosinThe serum concentration of Alfuzosin can be decreased when it is combined with Siltuximab.Approved, Investigational
AliskirenThe serum concentration of Aliskiren can be decreased when it is combined with Siltuximab.Approved, Investigational
AllylestrenolThe serum concentration of Allylestrenol can be decreased when it is combined with Siltuximab.Approved
AlmotriptanThe serum concentration of Almotriptan can be decreased when it is combined with Siltuximab.Approved, Investigational
AlogliptinThe serum concentration of Alogliptin can be decreased when it is combined with Siltuximab.Approved
AlosetronThe serum concentration of Alosetron can be decreased when it is combined with Siltuximab.Approved, Withdrawn
AlprazolamThe serum concentration of Alprazolam can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
AmbrisentanThe serum concentration of Ambrisentan can be decreased when it is combined with Siltuximab.Approved, Investigational
AmbroxolThe serum concentration of Ambroxol can be decreased when it is combined with Siltuximab.Approved
AminophenazoneThe serum concentration of Aminophenazone can be decreased when it is combined with Siltuximab.Approved, Withdrawn
AminophyllineThe serum concentration of Aminophylline can be decreased when it is combined with Siltuximab.Approved
AmiodaroneThe serum concentration of Amiodarone can be decreased when it is combined with Siltuximab.Approved, Investigational
AmitriptylineThe serum concentration of Amitriptyline can be decreased when it is combined with Siltuximab.Approved
AmlodipineThe serum concentration of Amlodipine can be decreased when it is combined with Siltuximab.Approved
AmprenavirThe serum concentration of Amprenavir can be decreased when it is combined with Siltuximab.Approved
AntipyrineThe serum concentration of Antipyrine can be decreased when it is combined with Siltuximab.Approved
ApixabanThe serum concentration of Apixaban can be decreased when it is combined with Siltuximab.Approved
ApremilastThe serum concentration of Apremilast can be decreased when it is combined with Siltuximab.Approved, Investigational
AprepitantThe serum concentration of Aprepitant can be decreased when it is combined with Siltuximab.Approved, Investigational
ArgatrobanThe serum concentration of Argatroban can be decreased when it is combined with Siltuximab.Approved, Investigational
AripiprazoleThe serum concentration of Aripiprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
ArtemetherThe serum concentration of Artemether can be decreased when it is combined with Siltuximab.Approved
AsenapineThe serum concentration of Asenapine can be decreased when it is combined with Siltuximab.Approved
AstemizoleThe serum concentration of Astemizole can be decreased when it is combined with Siltuximab.Approved, Withdrawn
AtazanavirThe serum concentration of Atazanavir can be decreased when it is combined with Siltuximab.Approved, Investigational
AtorvastatinThe serum concentration of Atorvastatin can be decreased when it is combined with Siltuximab.Approved
AvanafilThe serum concentration of Avanafil can be decreased when it is combined with Siltuximab.Approved
AxitinibThe serum concentration of Axitinib can be decreased when it is combined with Siltuximab.Approved, Investigational
AzelastineThe serum concentration of Azelastine can be decreased when it is combined with Siltuximab.Approved
AzithromycinThe serum concentration of Azithromycin can be decreased when it is combined with Siltuximab.Approved
BanoxantroneThe serum concentration of Banoxantrone can be decreased when it is combined with Siltuximab.Investigational
BCG vaccineThe therapeutic efficacy of Bcg can be decreased when used in combination with Siltuximab.Investigational
BedaquilineThe serum concentration of Bedaquiline can be decreased when it is combined with Siltuximab.Approved
BenzphetamineThe serum concentration of Benzphetamine can be decreased when it is combined with Siltuximab.Approved, Illicit
Benzyl alcoholThe serum concentration of Benzyl alcohol can be decreased when it is combined with Siltuximab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Siltuximab.Approved, Investigational
BexaroteneThe serum concentration of Bexarotene can be decreased when it is combined with Siltuximab.Approved, Investigational
BezafibrateThe serum concentration of Bezafibrate can be decreased when it is combined with Siltuximab.Approved
BicalutamideThe serum concentration of Bicalutamide can be decreased when it is combined with Siltuximab.Approved
BisoprololThe serum concentration of Bisoprolol can be decreased when it is combined with Siltuximab.Approved
BoceprevirThe serum concentration of Boceprevir can be decreased when it is combined with Siltuximab.Approved, Investigational
BortezomibThe serum concentration of Bortezomib can be decreased when it is combined with Siltuximab.Approved, Investigational
BosentanThe serum concentration of Bosentan can be decreased when it is combined with Siltuximab.Approved, Investigational
BosutinibThe serum concentration of Bosutinib can be decreased when it is combined with Siltuximab.Approved
Brentuximab vedotinThe serum concentration of Brentuximab vedotin can be decreased when it is combined with Siltuximab.Approved
BrexpiprazoleThe serum concentration of Brexpiprazole can be decreased when it is combined with Siltuximab.Approved
BrinzolamideThe serum concentration of Brinzolamide can be decreased when it is combined with Siltuximab.Approved
BromazepamThe serum concentration of Bromazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
BromocriptineThe serum concentration of Bromocriptine can be decreased when it is combined with Siltuximab.Approved, Investigational
BrompheniramineThe serum concentration of Brompheniramine can be decreased when it is combined with Siltuximab.Approved
BudesonideThe serum concentration of Budesonide can be decreased when it is combined with Siltuximab.Approved
BupivacaineThe serum concentration of Bupivacaine can be decreased when it is combined with Siltuximab.Approved, Investigational
BuprenorphineThe serum concentration of Buprenorphine can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Vet Approved
BupropionThe serum concentration of Bupropion can be decreased when it is combined with Siltuximab.Approved
BuspironeThe serum concentration of Buspirone can be decreased when it is combined with Siltuximab.Approved, Investigational
BusulfanThe serum concentration of Busulfan can be decreased when it is combined with Siltuximab.Approved, Investigational
CabazitaxelThe serum concentration of Cabazitaxel can be decreased when it is combined with Siltuximab.Approved
CabergolineThe serum concentration of Cabergoline can be decreased when it is combined with Siltuximab.Approved
CabozantinibThe serum concentration of Cabozantinib can be decreased when it is combined with Siltuximab.Approved
CaffeineThe serum concentration of Caffeine can be decreased when it is combined with Siltuximab.Approved
CalcitriolThe serum concentration of Calcitriol can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
CanagliflozinThe serum concentration of Canagliflozin can be decreased when it is combined with Siltuximab.Approved
CarbamazepineThe serum concentration of Carbamazepine can be decreased when it is combined with Siltuximab.Approved, Investigational
CarbinoxamineThe serum concentration of Carbinoxamine can be decreased when it is combined with Siltuximab.Approved
CariprazineThe serum concentration of Cariprazine can be decreased when it is combined with Siltuximab.Approved
CarvedilolThe serum concentration of Carvedilol can be decreased when it is combined with Siltuximab.Approved, Investigational
CelecoxibThe serum concentration of Celecoxib can be decreased when it is combined with Siltuximab.Approved, Investigational
CeliprololThe serum concentration of Celiprolol can be decreased when it is combined with Siltuximab.Approved, Investigational
CephalexinThe serum concentration of Cephalexin can be decreased when it is combined with Siltuximab.Approved, Vet Approved
CerivastatinThe serum concentration of Cerivastatin can be decreased when it is combined with Siltuximab.Withdrawn
CevimelineThe serum concentration of Cevimeline can be decreased when it is combined with Siltuximab.Approved
Chenodeoxycholic acidThe serum concentration of Chenodeoxycholic acid can be decreased when it is combined with Siltuximab.Approved
ChlordiazepoxideThe serum concentration of Chlordiazepoxide can be decreased when it is combined with Siltuximab.Approved, Illicit
ChloroquineThe serum concentration of Chloroquine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ChlorphenamineThe serum concentration of Chlorphenamine can be decreased when it is combined with Siltuximab.Approved
ChlorpromazineThe serum concentration of Chlorpromazine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ChlorzoxazoneThe serum concentration of Chlorzoxazone can be decreased when it is combined with Siltuximab.Approved
CholecalciferolThe serum concentration of Cholecalciferol can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
CiclesonideThe serum concentration of Ciclesonide can be decreased when it is combined with Siltuximab.Approved, Investigational
CilostazolThe serum concentration of Cilostazol can be decreased when it is combined with Siltuximab.Approved
CinacalcetThe serum concentration of Cinacalcet can be decreased when it is combined with Siltuximab.Approved
CisaprideThe serum concentration of Cisapride can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
CitalopramThe serum concentration of Citalopram can be decreased when it is combined with Siltuximab.Approved
ClarithromycinThe serum concentration of Clarithromycin can be decreased when it is combined with Siltuximab.Approved
ClindamycinThe serum concentration of Clindamycin can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ClobazamThe serum concentration of Clobazam can be decreased when it is combined with Siltuximab.Approved, Illicit
ClofazimineThe serum concentration of Clofazimine can be decreased when it is combined with Siltuximab.Approved, Investigational
ClofibrateThe serum concentration of Clofibrate can be decreased when it is combined with Siltuximab.Approved
ClomipramineThe serum concentration of Clomipramine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ClonazepamThe serum concentration of Clonazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
ClonidineThe serum concentration of Clonidine can be decreased when it is combined with Siltuximab.Approved
ClopidogrelThe serum concentration of Clopidogrel can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
ClorazepateThe serum concentration of Clorazepate can be decreased when it is combined with Siltuximab.Approved, Illicit
ClotiazepamThe serum concentration of Clotiazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
ClozapineThe serum concentration of Clozapine can be decreased when it is combined with Siltuximab.Approved
CocaineThe serum concentration of Cocaine can be decreased when it is combined with Siltuximab.Approved, Illicit
CodeineThe serum concentration of Codeine can be decreased when it is combined with Siltuximab.Approved, Illicit
ColchicineThe serum concentration of Colchicine can be decreased when it is combined with Siltuximab.Approved
ConivaptanThe serum concentration of Conivaptan can be decreased when it is combined with Siltuximab.Approved, Investigational
Conjugated estrogensThe serum concentration of Conjugated Equine Estrogens can be decreased when it is combined with Siltuximab.Approved
Cortisone acetateThe serum concentration of Cortisone acetate can be decreased when it is combined with Siltuximab.Approved
CrizotinibThe serum concentration of Crizotinib can be decreased when it is combined with Siltuximab.Approved
CyclobenzaprineThe serum concentration of Cyclobenzaprine can be decreased when it is combined with Siltuximab.Approved
CyclophosphamideThe serum concentration of Cyclophosphamide can be decreased when it is combined with Siltuximab.Approved, Investigational
CyclosporineThe serum concentration of Cyclosporine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
CytarabineThe serum concentration of Cytarabine can be decreased when it is combined with Siltuximab.Approved, Investigational
DabrafenibThe serum concentration of Dabrafenib can be decreased when it is combined with Siltuximab.Approved
DaclatasvirThe serum concentration of Daclatasvir can be decreased when it is combined with Siltuximab.Approved
DantroleneThe serum concentration of Dantrolene can be decreased when it is combined with Siltuximab.Approved
DapagliflozinThe serum concentration of Dapagliflozin can be decreased when it is combined with Siltuximab.Approved
DapsoneThe serum concentration of Dapsone can be decreased when it is combined with Siltuximab.Approved, Investigational
DarifenacinThe serum concentration of Darifenacin can be decreased when it is combined with Siltuximab.Approved, Investigational
DarunavirThe serum concentration of Darunavir can be decreased when it is combined with Siltuximab.Approved
DasabuvirThe serum concentration of Dasabuvir can be decreased when it is combined with Siltuximab.Approved
DasatinibThe serum concentration of Dasatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
DaunorubicinThe serum concentration of Daunorubicin can be decreased when it is combined with Siltuximab.Approved
DelavirdineThe serum concentration of Delavirdine can be decreased when it is combined with Siltuximab.Approved
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Siltuximab.Approved
DeslanosideDeslanoside may decrease the cardiotoxic activities of Siltuximab.Approved
DesvenlafaxineThe serum concentration of Desvenlafaxine can be decreased when it is combined with Siltuximab.Approved
DexamethasoneThe serum concentration of Dexamethasone can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
DextromethorphanThe serum concentration of Dextromethorphan can be decreased when it is combined with Siltuximab.Approved
DextropropoxypheneThe serum concentration of Dextropropoxyphene can be decreased when it is combined with Siltuximab.Approved, Illicit, Withdrawn
DiazepamThe serum concentration of Diazepam can be decreased when it is combined with Siltuximab.Approved, Illicit, Vet Approved
DiclofenacThe serum concentration of Diclofenac can be decreased when it is combined with Siltuximab.Approved, Vet Approved
DigitoxinThe serum concentration of Digitoxin can be decreased when it is combined with Siltuximab.Approved
DigoxinThe serum concentration of Digoxin can be decreased when it is combined with Siltuximab.Approved
DihydrocodeineThe serum concentration of Dihydrocodeine can be decreased when it is combined with Siltuximab.Approved, Illicit
DihydroergotamineThe serum concentration of Dihydroergotamine can be decreased when it is combined with Siltuximab.Approved
DiltiazemThe serum concentration of Diltiazem can be decreased when it is combined with Siltuximab.Approved
DisopyramideThe serum concentration of Disopyramide can be decreased when it is combined with Siltuximab.Approved
DisulfiramThe serum concentration of Disulfiram can be decreased when it is combined with Siltuximab.Approved
DocetaxelThe serum concentration of Docetaxel can be decreased when it is combined with Siltuximab.Approved, Investigational
DofetilideThe serum concentration of Dofetilide can be decreased when it is combined with Siltuximab.Approved
DolasetronThe serum concentration of Dolasetron can be decreased when it is combined with Siltuximab.Approved
DomperidoneThe serum concentration of Domperidone can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
DonepezilThe serum concentration of Donepezil can be decreased when it is combined with Siltuximab.Approved
DorzolamideThe serum concentration of Dorzolamide can be decreased when it is combined with Siltuximab.Approved
DoxepinThe serum concentration of Doxepin can be decreased when it is combined with Siltuximab.Approved
DoxorubicinThe serum concentration of Doxorubicin can be decreased when it is combined with Siltuximab.Approved, Investigational
DronabinolThe serum concentration of Dronabinol can be decreased when it is combined with Siltuximab.Approved, Illicit
DronedaroneThe serum concentration of Dronedarone can be decreased when it is combined with Siltuximab.Approved
DutasterideThe serum concentration of Dutasteride can be decreased when it is combined with Siltuximab.Approved, Investigational
EfavirenzThe serum concentration of Efavirenz can be decreased when it is combined with Siltuximab.Approved, Investigational
EletriptanThe serum concentration of Eletriptan can be decreased when it is combined with Siltuximab.Approved, Investigational
EliglustatThe serum concentration of Eliglustat can be decreased when it is combined with Siltuximab.Approved
ElvitegravirThe serum concentration of Elvitegravir can be decreased when it is combined with Siltuximab.Approved
EnalaprilThe serum concentration of Enalapril can be decreased when it is combined with Siltuximab.Approved, Vet Approved
EnzalutamideThe serum concentration of Enzalutamide can be decreased when it is combined with Siltuximab.Approved
EpinastineThe serum concentration of Epinastine can be decreased when it is combined with Siltuximab.Approved, Investigational
EplerenoneThe serum concentration of Eplerenone can be decreased when it is combined with Siltuximab.Approved
ErgocalciferolThe serum concentration of Ergocalciferol can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
Ergoloid mesylateThe serum concentration of Ergoloid mesylate can be decreased when it is combined with Siltuximab.Approved
ErgonovineThe serum concentration of Ergonovine can be decreased when it is combined with Siltuximab.Approved
ErgotamineThe serum concentration of Ergotamine can be decreased when it is combined with Siltuximab.Approved
ErlotinibThe serum concentration of Erlotinib can be decreased when it is combined with Siltuximab.Approved, Investigational
ErythromycinThe serum concentration of Erythromycin can be decreased when it is combined with Siltuximab.Approved, Vet Approved
EscitalopramThe serum concentration of Escitalopram can be decreased when it is combined with Siltuximab.Approved, Investigational
EsomeprazoleThe serum concentration of Esomeprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
EstazolamThe serum concentration of Estazolam can be decreased when it is combined with Siltuximab.Approved, Illicit
EstradiolThe serum concentration of Estradiol can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
EstramustineThe serum concentration of Estramustine can be decreased when it is combined with Siltuximab.Approved
EstroneThe serum concentration of Estrone can be decreased when it is combined with Siltuximab.Approved
Estrone sulfateThe serum concentration of Estrone sulfate can be decreased when it is combined with Siltuximab.Approved
EszopicloneThe serum concentration of Eszopiclone can be decreased when it is combined with Siltuximab.Approved
EthanolThe serum concentration of Ethanol can be decreased when it is combined with Siltuximab.Approved
Ethinyl EstradiolThe serum concentration of Ethinyl Estradiol can be decreased when it is combined with Siltuximab.Approved
EthosuximideThe serum concentration of Ethosuximide can be decreased when it is combined with Siltuximab.Approved
EthylmorphineThe serum concentration of Ethylmorphine can be decreased when it is combined with Siltuximab.Approved, Illicit
EtonogestrelThe serum concentration of Etonogestrel can be decreased when it is combined with Siltuximab.Approved, Investigational
EtoposideThe serum concentration of Etoposide can be decreased when it is combined with Siltuximab.Approved
EtoricoxibThe serum concentration of Etoricoxib can be decreased when it is combined with Siltuximab.Approved, Investigational
EtravirineThe serum concentration of Etravirine can be decreased when it is combined with Siltuximab.Approved
EverolimusThe serum concentration of Everolimus can be decreased when it is combined with Siltuximab.Approved
ExemestaneThe serum concentration of Exemestane can be decreased when it is combined with Siltuximab.Approved, Investigational
FamciclovirThe serum concentration of Famciclovir can be decreased when it is combined with Siltuximab.Approved
FelbamateThe serum concentration of Felbamate can be decreased when it is combined with Siltuximab.Approved
FelodipineThe serum concentration of Felodipine can be decreased when it is combined with Siltuximab.Approved, Investigational
FenofibrateThe serum concentration of Fenofibrate can be decreased when it is combined with Siltuximab.Approved
FentanylThe serum concentration of Fentanyl can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Vet Approved
FesoterodineThe serum concentration of Fesoterodine can be decreased when it is combined with Siltuximab.Approved
FinasterideThe serum concentration of Finasteride can be decreased when it is combined with Siltuximab.Approved
FingolimodSiltuximab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
FlibanserinThe serum concentration of Flibanserin can be decreased when it is combined with Siltuximab.Approved
FlunisolideThe serum concentration of Flunisolide can be decreased when it is combined with Siltuximab.Approved, Investigational
FlunitrazepamThe serum concentration of Flunitrazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
FluorometholoneThe serum concentration of Fluorometholone can be decreased when it is combined with Siltuximab.Approved
FluoxetineThe serum concentration of Fluoxetine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
FlurazepamThe serum concentration of Flurazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
FlutamideThe serum concentration of Flutamide can be decreased when it is combined with Siltuximab.Approved
Fluticasone furoateThe serum concentration of Fluticasone furoate can be decreased when it is combined with Siltuximab.Approved
Fluticasone propionateThe serum concentration of Fluticasone Propionate can be decreased when it is combined with Siltuximab.Approved
FluvastatinThe serum concentration of Fluvastatin can be decreased when it is combined with Siltuximab.Approved
FosamprenavirThe serum concentration of Fosamprenavir can be decreased when it is combined with Siltuximab.Approved
FulvestrantThe serum concentration of Fulvestrant can be decreased when it is combined with Siltuximab.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Siltuximab is combined with G17DT.Investigational
GalantamineThe serum concentration of Galantamine can be decreased when it is combined with Siltuximab.Approved
GefitinibThe serum concentration of Gefitinib can be decreased when it is combined with Siltuximab.Approved, Investigational
GemfibrozilThe serum concentration of Gemfibrozil can be decreased when it is combined with Siltuximab.Approved
GlipizideThe serum concentration of Glipizide can be decreased when it is combined with Siltuximab.Approved
GlyburideThe serum concentration of Glyburide can be decreased when it is combined with Siltuximab.Approved
GranisetronThe serum concentration of Granisetron can be decreased when it is combined with Siltuximab.Approved, Investigational
GrepafloxacinThe serum concentration of Grepafloxacin can be decreased when it is combined with Siltuximab.Withdrawn
GuanfacineThe serum concentration of Guanfacine can be decreased when it is combined with Siltuximab.Approved, Investigational
HalofantrineThe serum concentration of Halofantrine can be decreased when it is combined with Siltuximab.Approved
HaloperidolThe serum concentration of Haloperidol can be decreased when it is combined with Siltuximab.Approved
HalothaneThe serum concentration of Halothane can be decreased when it is combined with Siltuximab.Approved, Vet Approved
HexobarbitalThe serum concentration of Hexobarbital can be decreased when it is combined with Siltuximab.Approved
HistamineThe serum concentration of Histamine Phosphate can be decreased when it is combined with Siltuximab.Approved, Investigational
HydrocodoneThe serum concentration of Hydrocodone can be decreased when it is combined with Siltuximab.Approved, Illicit
HydrocortisoneThe serum concentration of Hydrocortisone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
HydromorphoneThe serum concentration of Hydromorphone can be decreased when it is combined with Siltuximab.Approved, Illicit
Hydroxyprogesterone caproateThe serum concentration of Hydroxyprogesterone caproate can be decreased when it is combined with Siltuximab.Approved
IbrutinibThe serum concentration of Ibrutinib can be decreased when it is combined with Siltuximab.Approved
IfosfamideThe serum concentration of Ifosfamide can be decreased when it is combined with Siltuximab.Approved
IloperidoneThe serum concentration of Iloperidone can be decreased when it is combined with Siltuximab.Approved
ImatinibThe serum concentration of Imatinib can be decreased when it is combined with Siltuximab.Approved
ImipramineThe serum concentration of Imipramine can be decreased when it is combined with Siltuximab.Approved
ImiquimodThe serum concentration of Imiquimod can be decreased when it is combined with Siltuximab.Approved, Investigational
IndacaterolThe serum concentration of Indacaterol can be decreased when it is combined with Siltuximab.Approved
IndapamideThe serum concentration of Indapamide can be decreased when it is combined with Siltuximab.Approved
IndinavirThe serum concentration of Indinavir can be decreased when it is combined with Siltuximab.Approved
INGN 201The risk or severity of adverse effects can be increased when Siltuximab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Siltuximab is combined with INGN 225.Investigational
Ipratropium bromideThe serum concentration of Ipratropium bromide can be decreased when it is combined with Siltuximab.Approved
IrinotecanThe serum concentration of Irinotecan can be decreased when it is combined with Siltuximab.Approved, Investigational
IsavuconazoniumThe serum concentration of Isavuconazonium can be decreased when it is combined with Siltuximab.Approved, Investigational
Isosorbide DinitrateThe serum concentration of Isosorbide Dinitrate can be decreased when it is combined with Siltuximab.Approved
Isosorbide MononitrateThe serum concentration of Isosorbide Mononitrate can be decreased when it is combined with Siltuximab.Approved
IsradipineThe serum concentration of Isradipine can be decreased when it is combined with Siltuximab.Approved
ItraconazoleThe serum concentration of Itraconazole can be decreased when it is combined with Siltuximab.Approved, Investigational
IvabradineThe serum concentration of Ivabradine can be decreased when it is combined with Siltuximab.Approved
IvacaftorThe serum concentration of Ivacaftor can be decreased when it is combined with Siltuximab.Approved
IvermectinThe serum concentration of Ivermectin can be decreased when it is combined with Siltuximab.Approved, Vet Approved
IxabepiloneThe serum concentration of Ixabepilone can be decreased when it is combined with Siltuximab.Approved, Investigational
IxazomibThe serum concentration of Ixazomib can be decreased when it is combined with Siltuximab.Approved
KetamineThe serum concentration of Ketamine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
KetazolamThe serum concentration of Ketazolam can be decreased when it is combined with Siltuximab.Approved
KetobemidoneThe serum concentration of Ketobemidone can be decreased when it is combined with Siltuximab.Approved
KetoconazoleThe serum concentration of Ketoconazole can be decreased when it is combined with Siltuximab.Approved, Investigational
LansoprazoleThe serum concentration of Lansoprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
LapatinibThe serum concentration of Lapatinib can be decreased when it is combined with Siltuximab.Approved, Investigational
LaquinimodThe serum concentration of Laquinimod can be decreased when it is combined with Siltuximab.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Siltuximab is combined with Leflunomide.Approved, Investigational
LenvatinibThe serum concentration of Lenvatinib can be decreased when it is combined with Siltuximab.Approved
LercanidipineThe serum concentration of Lercanidipine can be decreased when it is combined with Siltuximab.Approved, Investigational
LetrozoleThe serum concentration of Letrozole can be decreased when it is combined with Siltuximab.Approved, Investigational
LevobupivacaineThe serum concentration of Levobupivacaine can be decreased when it is combined with Siltuximab.Approved
LevocetirizineThe serum concentration of Levocetirizine can be decreased when it is combined with Siltuximab.Approved
Levomethadyl AcetateThe serum concentration of Levomethadyl Acetate can be decreased when it is combined with Siltuximab.Approved
LevomilnacipranThe serum concentration of Levomilnacipran can be decreased when it is combined with Siltuximab.Approved
LevonorgestrelThe serum concentration of Levonorgestrel can be decreased when it is combined with Siltuximab.Approved, Investigational
LevothyroxineThe serum concentration of Levothyroxine can be decreased when it is combined with Siltuximab.Approved
LidocaineThe serum concentration of Lidocaine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
LisurideThe serum concentration of Lisuride can be decreased when it is combined with Siltuximab.Approved
LomitapideThe serum concentration of Lomitapide can be decreased when it is combined with Siltuximab.Approved
LoperamideThe serum concentration of Loperamide can be decreased when it is combined with Siltuximab.Approved
LopinavirThe serum concentration of Lopinavir can be decreased when it is combined with Siltuximab.Approved
LoratadineThe serum concentration of Loratadine can be decreased when it is combined with Siltuximab.Approved
LorcaserinThe serum concentration of Lorcaserin can be decreased when it is combined with Siltuximab.Approved
LosartanThe serum concentration of Losartan can be decreased when it is combined with Siltuximab.Approved
LovastatinThe serum concentration of Lovastatin can be decreased when it is combined with Siltuximab.Approved, Investigational
LumefantrineThe serum concentration of Lumefantrine can be decreased when it is combined with Siltuximab.Approved
LurasidoneThe serum concentration of Lurasidone can be decreased when it is combined with Siltuximab.Approved
MacitentanThe serum concentration of Macitentan can be decreased when it is combined with Siltuximab.Approved
MaravirocThe serum concentration of Maraviroc can be decreased when it is combined with Siltuximab.Approved, Investigational
MebendazoleThe serum concentration of Mebendazole can be decreased when it is combined with Siltuximab.Approved, Vet Approved
Medroxyprogesterone acetateThe serum concentration of Medroxyprogesterone acetate can be decreased when it is combined with Siltuximab.Approved, Investigational
MefloquineThe serum concentration of Mefloquine can be decreased when it is combined with Siltuximab.Approved
MeloxicamThe serum concentration of Meloxicam can be decreased when it is combined with Siltuximab.Approved, Vet Approved
MethadoneThe serum concentration of Methadone can be decreased when it is combined with Siltuximab.Approved
MethaqualoneThe serum concentration of Methaqualone can be decreased when it is combined with Siltuximab.Illicit, Withdrawn
MethoxsalenThe serum concentration of Methoxsalen can be decreased when it is combined with Siltuximab.Approved
MethoxyfluraneThe serum concentration of Methoxyflurane can be decreased when it is combined with Siltuximab.Approved, Vet Approved
MethylprednisoloneThe serum concentration of Methylprednisolone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
MethyltestosteroneThe serum concentration of Methyltestosterone can be decreased when it is combined with Siltuximab.Approved
MetronidazoleThe serum concentration of Metronidazole can be decreased when it is combined with Siltuximab.Approved
MexiletineThe serum concentration of Mexiletine can be decreased when it is combined with Siltuximab.Approved
MianserinThe serum concentration of Mianserin can be decreased when it is combined with Siltuximab.Approved
MibefradilThe serum concentration of Mibefradil can be decreased when it is combined with Siltuximab.Withdrawn
MiconazoleThe serum concentration of Miconazole can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
MidazolamThe serum concentration of Midazolam can be decreased when it is combined with Siltuximab.Approved, Illicit
MifepristoneThe serum concentration of Mifepristone can be decreased when it is combined with Siltuximab.Approved, Investigational
MirabegronThe serum concentration of Mirabegron can be decreased when it is combined with Siltuximab.Approved
MirtazapineThe serum concentration of Mirtazapine can be decreased when it is combined with Siltuximab.Approved
ModafinilThe serum concentration of Modafinil can be decreased when it is combined with Siltuximab.Approved, Investigational
MontelukastThe serum concentration of Montelukast can be decreased when it is combined with Siltuximab.Approved
MorphineThe serum concentration of Morphine can be decreased when it is combined with Siltuximab.Approved, Investigational
Mycophenolate mofetilThe serum concentration of Mycophenolate mofetil can be decreased when it is combined with Siltuximab.Approved, Investigational
NaloxegolThe serum concentration of Naloxegol can be decreased when it is combined with Siltuximab.Approved
NaloxoneThe serum concentration of Naloxone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
NatalizumabThe risk or severity of adverse effects can be increased when Siltuximab is combined with Natalizumab.Approved, Investigational
NateglinideThe serum concentration of Nateglinide can be decreased when it is combined with Siltuximab.Approved, Investigational
NefazodoneThe serum concentration of Nefazodone can be decreased when it is combined with Siltuximab.Approved, Withdrawn
NelfinavirThe serum concentration of Nelfinavir can be decreased when it is combined with Siltuximab.Approved
NevirapineThe serum concentration of Nevirapine can be decreased when it is combined with Siltuximab.Approved
NicardipineThe serum concentration of Nicardipine can be decreased when it is combined with Siltuximab.Approved
NicotineThe serum concentration of Nicotine can be decreased when it is combined with Siltuximab.Approved
NifedipineThe serum concentration of Nifedipine can be decreased when it is combined with Siltuximab.Approved
NilotinibThe serum concentration of Nilotinib can be decreased when it is combined with Siltuximab.Approved, Investigational
NilvadipineThe serum concentration of Nilvadipine can be decreased when it is combined with Siltuximab.Approved
NimodipineThe serum concentration of Nimodipine can be decreased when it is combined with Siltuximab.Approved
NisoldipineThe serum concentration of Nisoldipine can be decreased when it is combined with Siltuximab.Approved
NitrazepamThe serum concentration of Nitrazepam can be decreased when it is combined with Siltuximab.Approved
NitrendipineThe serum concentration of Nitrendipine can be decreased when it is combined with Siltuximab.Approved
NorethisteroneThe serum concentration of Norethisterone can be decreased when it is combined with Siltuximab.Approved
NorgestrelThe serum concentration of Norgestrel can be decreased when it is combined with Siltuximab.Approved
NortriptylineThe serum concentration of Nortriptyline can be decreased when it is combined with Siltuximab.Approved
OlaparibThe serum concentration of Olaparib can be decreased when it is combined with Siltuximab.Approved
OleandrinAnvirzel may decrease the cardiotoxic activities of Siltuximab.Experimental
OlopatadineThe serum concentration of Olopatadine can be decreased when it is combined with Siltuximab.Approved
OmeprazoleThe serum concentration of Omeprazole can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
OndansetronThe serum concentration of Ondansetron can be decreased when it is combined with Siltuximab.Approved
OrphenadrineThe serum concentration of Orphenadrine can be decreased when it is combined with Siltuximab.Approved
OspemifeneThe serum concentration of Ospemifene can be decreased when it is combined with Siltuximab.Approved
OuabainOuabain may decrease the cardiotoxic activities of Siltuximab.Approved
OxazepamThe serum concentration of Oxazepam can be decreased when it is combined with Siltuximab.Approved
OxybutyninThe serum concentration of Oxybutynin can be decreased when it is combined with Siltuximab.Approved, Investigational
OxycodoneThe serum concentration of Oxycodone can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
OxymorphoneThe serum concentration of Oxymorphone can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
PaclitaxelThe serum concentration of Paclitaxel can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PalbociclibThe serum concentration of Palbociclib can be decreased when it is combined with Siltuximab.Approved
PalonosetronThe serum concentration of Palonosetron can be decreased when it is combined with Siltuximab.Approved, Investigational
PanobinostatThe serum concentration of Panobinostat can be decreased when it is combined with Siltuximab.Approved, Investigational
PantoprazoleThe serum concentration of Pantoprazole can be decreased when it is combined with Siltuximab.Approved
ParamethadioneThe serum concentration of Paramethadione can be decreased when it is combined with Siltuximab.Approved
ParamethasoneThe serum concentration of Paramethasone can be decreased when it is combined with Siltuximab.Approved
ParecoxibThe serum concentration of Parecoxib can be decreased when it is combined with Siltuximab.Approved
ParicalcitolThe serum concentration of Paricalcitol can be decreased when it is combined with Siltuximab.Approved, Investigational
ParitaprevirThe serum concentration of Paritaprevir can be decreased when it is combined with Siltuximab.Approved
PazopanibThe serum concentration of Pazopanib can be decreased when it is combined with Siltuximab.Approved
PentamidineThe serum concentration of Pentamidine can be decreased when it is combined with Siltuximab.Approved
PerampanelThe serum concentration of Perampanel can be decreased when it is combined with Siltuximab.Approved
PergolideThe serum concentration of Pergolide can be decreased when it is combined with Siltuximab.Approved, Vet Approved, Withdrawn
PerhexilineThe serum concentration of Perhexiline can be decreased when it is combined with Siltuximab.Approved
PermethrinThe serum concentration of Permethrin can be decreased when it is combined with Siltuximab.Approved, Investigational
PerphenazineThe serum concentration of Perphenazine can be decreased when it is combined with Siltuximab.Approved
PethidineThe serum concentration of Pethidine can be decreased when it is combined with Siltuximab.Approved
PhenacetinThe serum concentration of Phenacetin can be decreased when it is combined with Siltuximab.Withdrawn
PhenoxybenzamineThe serum concentration of Phenoxybenzamine can be decreased when it is combined with Siltuximab.Approved
PhenprocoumonThe serum concentration of Phenprocoumon can be decreased when it is combined with Siltuximab.Approved
PhenytoinThe serum concentration of Phenytoin can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PilocarpineThe serum concentration of Pilocarpine can be decreased when it is combined with Siltuximab.Approved
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Siltuximab.Approved, Investigational
PimozideThe serum concentration of Pimozide can be decreased when it is combined with Siltuximab.Approved
PioglitazoneThe serum concentration of Pioglitazone can be decreased when it is combined with Siltuximab.Approved, Investigational
PipotiazineThe serum concentration of Pipotiazine can be decreased when it is combined with Siltuximab.Approved
PodofiloxThe serum concentration of Podofilox can be decreased when it is combined with Siltuximab.Approved
PomalidomideThe serum concentration of Pomalidomide can be decreased when it is combined with Siltuximab.Approved
PonatinibThe serum concentration of Ponatinib can be decreased when it is combined with Siltuximab.Approved
PosaconazoleThe serum concentration of Posaconazole can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
PrasteroneThe serum concentration of Prasterone can be decreased when it is combined with Siltuximab.Approved, Nutraceutical
PrasugrelThe serum concentration of Prasugrel can be decreased when it is combined with Siltuximab.Approved
PravastatinThe serum concentration of Pravastatin can be decreased when it is combined with Siltuximab.Approved
PrazepamThe serum concentration of Prazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
PraziquantelThe serum concentration of Praziquantel can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PrednisoloneThe serum concentration of Prednisolone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PrednisoneThe serum concentration of Prednisone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PrimaquineThe serum concentration of Primaquine can be decreased when it is combined with Siltuximab.Approved
ProchlorperazineThe serum concentration of Prochlorperazine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ProgesteroneThe serum concentration of Progesterone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ProguanilThe serum concentration of Proguanil can be decreased when it is combined with Siltuximab.Approved
PromazineThe serum concentration of Promazine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
PropafenoneThe serum concentration of Propafenone can be decreased when it is combined with Siltuximab.Approved
PropofolThe serum concentration of Propofol can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
PropranololThe serum concentration of Propranolol can be decreased when it is combined with Siltuximab.Approved, Investigational
PyrazinamideThe serum concentration of Pyrazinamide can be decreased when it is combined with Siltuximab.Approved
QuazepamThe serum concentration of Quazepam can be decreased when it is combined with Siltuximab.Approved, Illicit
QuetiapineThe serum concentration of Quetiapine can be decreased when it is combined with Siltuximab.Approved
QuinacrineThe serum concentration of Quinacrine can be decreased when it is combined with Siltuximab.Approved
QuinidineThe serum concentration of Quinidine can be decreased when it is combined with Siltuximab.Approved
QuinineThe serum concentration of Quinine can be decreased when it is combined with Siltuximab.Approved
RabeprazoleThe serum concentration of Rabeprazole can be decreased when it is combined with Siltuximab.Approved, Investigational
RaloxifeneThe serum concentration of Raloxifene can be decreased when it is combined with Siltuximab.Approved, Investigational
RamelteonThe serum concentration of Ramelteon can be decreased when it is combined with Siltuximab.Approved, Investigational
RanolazineThe serum concentration of Ranolazine can be decreased when it is combined with Siltuximab.Approved, Investigational
ReboxetineThe serum concentration of Reboxetine can be decreased when it is combined with Siltuximab.Approved, Investigational
RegorafenibThe serum concentration of Regorafenib can be decreased when it is combined with Siltuximab.Approved
RepaglinideThe serum concentration of Repaglinide can be decreased when it is combined with Siltuximab.Approved, Investigational
RetapamulinThe serum concentration of Retapamulin can be decreased when it is combined with Siltuximab.Approved
RifabutinThe serum concentration of Rifabutin can be decreased when it is combined with Siltuximab.Approved
RifampicinThe serum concentration of Rifampicin can be decreased when it is combined with Siltuximab.Approved
RilpivirineThe serum concentration of Rilpivirine can be decreased when it is combined with Siltuximab.Approved
RimonabantThe serum concentration of Rimonabant can be decreased when it is combined with Siltuximab.Approved, Investigational
RindopepimutThe risk or severity of adverse effects can be increased when Siltuximab is combined with CDX-110.Investigational
RiociguatThe serum concentration of Riociguat can be decreased when it is combined with Siltuximab.Approved
RisperidoneThe serum concentration of Risperidone can be decreased when it is combined with Siltuximab.Approved, Investigational
RitonavirThe serum concentration of Ritonavir can be decreased when it is combined with Siltuximab.Approved, Investigational
RivaroxabanThe serum concentration of Rivaroxaban can be decreased when it is combined with Siltuximab.Approved
RofecoxibThe serum concentration of Rofecoxib can be decreased when it is combined with Siltuximab.Investigational, Withdrawn
RoflumilastRoflumilast may increase the immunosuppressive activities of Siltuximab.Approved
RolapitantThe serum concentration of Rolapitant can be decreased when it is combined with Siltuximab.Approved
RomidepsinThe serum concentration of Romidepsin can be decreased when it is combined with Siltuximab.Approved, Investigational
RopiniroleThe serum concentration of Ropinirole can be decreased when it is combined with Siltuximab.Approved, Investigational
RopivacaineThe serum concentration of Ropivacaine can be decreased when it is combined with Siltuximab.Approved
RosuvastatinThe serum concentration of Rosuvastatin can be decreased when it is combined with Siltuximab.Approved
RotigotineThe serum concentration of Rotigotine can be decreased when it is combined with Siltuximab.Approved
RoxithromycinThe serum concentration of Roxithromycin can be decreased when it is combined with Siltuximab.Approved, Withdrawn
RuxolitinibThe serum concentration of Ruxolitinib can be decreased when it is combined with Siltuximab.Approved
SalmeterolThe serum concentration of Salmeterol can be decreased when it is combined with Siltuximab.Approved
SaquinavirThe serum concentration of Saquinavir can be decreased when it is combined with Siltuximab.Approved, Investigational
SaxagliptinThe serum concentration of Saxagliptin can be decreased when it is combined with Siltuximab.Approved
SelegilineThe serum concentration of Selegiline can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
SelexipagThe serum concentration of Selexipag can be decreased when it is combined with Siltuximab.Approved
SertindoleThe serum concentration of Sertindole can be decreased when it is combined with Siltuximab.Approved, Withdrawn
SertralineThe serum concentration of Sertraline can be decreased when it is combined with Siltuximab.Approved
SevofluraneThe serum concentration of Sevoflurane can be decreased when it is combined with Siltuximab.Approved, Vet Approved
SibutramineThe serum concentration of Sibutramine can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational, Withdrawn
SildenafilThe serum concentration of Sildenafil can be decreased when it is combined with Siltuximab.Approved, Investigational
SilodosinThe serum concentration of Silodosin can be decreased when it is combined with Siltuximab.Approved
SimeprevirThe serum concentration of Simeprevir can be decreased when it is combined with Siltuximab.Approved
SimvastatinThe serum concentration of Simvastatin can be decreased when it is combined with Siltuximab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Siltuximab.Approved
SirolimusThe serum concentration of Sirolimus can be decreased when it is combined with Siltuximab.Approved, Investigational
SitagliptinThe serum concentration of Sitagliptin can be decreased when it is combined with Siltuximab.Approved, Investigational
SolifenacinThe serum concentration of Solifenacin can be decreased when it is combined with Siltuximab.Approved
SonidegibThe serum concentration of Sonidegib can be decreased when it is combined with Siltuximab.Approved, Investigational
SorafenibThe serum concentration of Sorafenib can be decreased when it is combined with Siltuximab.Approved, Investigational
SpiramycinThe serum concentration of Spiramycin can be decreased when it is combined with Siltuximab.Approved
SRP 299The risk or severity of adverse effects can be increased when Siltuximab is combined with SRP 299.Investigational
SufentanilThe serum concentration of Sufentanil can be decreased when it is combined with Siltuximab.Approved, Investigational
SulfadiazineThe serum concentration of Sulfadiazine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
SulfamethoxazoleThe serum concentration of Sulfamethoxazole can be decreased when it is combined with Siltuximab.Approved
SulfinpyrazoneThe serum concentration of Sulfinpyrazone can be decreased when it is combined with Siltuximab.Approved
SunitinibThe serum concentration of Sunitinib can be decreased when it is combined with Siltuximab.Approved, Investigational
Synthetic Conjugated Estrogens, AThe serum concentration of Synthetic Conjugated Estrogens, A can be decreased when it is combined with Siltuximab.Approved
Synthetic Conjugated Estrogens, BThe serum concentration of Synthetic Conjugated Estrogens, B can be decreased when it is combined with Siltuximab.Approved
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Siltuximab.Approved, Investigational
TacrolimusThe serum concentration of Tacrolimus can be decreased when it is combined with Siltuximab.Approved, Investigational
TadalafilThe serum concentration of Tadalafil can be decreased when it is combined with Siltuximab.Approved, Investigational
TamoxifenThe serum concentration of Tamoxifen can be decreased when it is combined with Siltuximab.Approved
TamsulosinThe serum concentration of Tamsulosin can be decreased when it is combined with Siltuximab.Approved, Investigational
TasosartanThe serum concentration of Tasosartan can be decreased when it is combined with Siltuximab.Approved
TelaprevirThe serum concentration of Telaprevir can be decreased when it is combined with Siltuximab.Withdrawn
TelithromycinThe serum concentration of Telithromycin can be decreased when it is combined with Siltuximab.Approved
TemazepamThe serum concentration of Temazepam can be decreased when it is combined with Siltuximab.Approved
TemsirolimusThe serum concentration of Temsirolimus can be decreased when it is combined with Siltuximab.Approved
TeniposideThe serum concentration of Teniposide can be decreased when it is combined with Siltuximab.Approved
TerbinafineThe serum concentration of Terbinafine can be decreased when it is combined with Siltuximab.Approved, Investigational, Vet Approved
TerfenadineThe serum concentration of Terfenadine can be decreased when it is combined with Siltuximab.Withdrawn
TesmilifeneThe serum concentration of Tesmilifene can be decreased when it is combined with Siltuximab.Investigational
TestosteroneThe serum concentration of Testosterone can be decreased when it is combined with Siltuximab.Approved, Investigational
TetracyclineThe serum concentration of Tetracycline can be decreased when it is combined with Siltuximab.Approved, Vet Approved
TheophyllineThe serum concentration of Theophylline can be decreased when it is combined with Siltuximab.Approved
ThiotepaThe serum concentration of Thiotepa can be decreased when it is combined with Siltuximab.Approved
TiagabineThe serum concentration of Tiagabine can be decreased when it is combined with Siltuximab.Approved
TicagrelorThe serum concentration of Ticagrelor can be decreased when it is combined with Siltuximab.Approved
TiclopidineThe serum concentration of Ticlopidine can be decreased when it is combined with Siltuximab.Approved
TinidazoleThe serum concentration of Tinidazole can be decreased when it is combined with Siltuximab.Approved, Investigational
TiotropiumThe serum concentration of Tiotropium can be decreased when it is combined with Siltuximab.Approved
TipranavirThe serum concentration of Tipranavir can be decreased when it is combined with Siltuximab.Approved, Investigational
TofacitinibSiltuximab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TolterodineThe serum concentration of Tolterodine can be decreased when it is combined with Siltuximab.Approved, Investigational
TolvaptanThe serum concentration of Tolvaptan can be decreased when it is combined with Siltuximab.Approved
ToremifeneThe serum concentration of Toremifene can be decreased when it is combined with Siltuximab.Approved, Investigational
TrabectedinThe serum concentration of Trabectedin can be decreased when it is combined with Siltuximab.Approved, Investigational
TramadolThe serum concentration of Tramadol can be decreased when it is combined with Siltuximab.Approved, Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Siltuximab.Approved, Investigational
Trastuzumab emtansineThe serum concentration of Trastuzumab emtansine can be decreased when it is combined with Siltuximab.Approved
TrazodoneThe serum concentration of Trazodone can be decreased when it is combined with Siltuximab.Approved, Investigational
TretinoinThe serum concentration of Tretinoin can be decreased when it is combined with Siltuximab.Approved, Investigational, Nutraceutical
TriamcinoloneThe serum concentration of Triamcinolone can be decreased when it is combined with Siltuximab.Approved, Vet Approved
TriazolamThe serum concentration of Triazolam can be decreased when it is combined with Siltuximab.Approved
TrimethadioneThe serum concentration of Trimethadione can be decreased when it is combined with Siltuximab.Approved
TrimethoprimThe serum concentration of Trimethoprim can be decreased when it is combined with Siltuximab.Approved, Vet Approved
TrimipramineThe serum concentration of Trimipramine can be decreased when it is combined with Siltuximab.Approved
TroglitazoneThe serum concentration of Troglitazone can be decreased when it is combined with Siltuximab.Withdrawn
UdenafilThe serum concentration of Udenafil can be decreased when it is combined with Siltuximab.Approved, Investigational
UlipristalThe serum concentration of Ulipristal can be decreased when it is combined with Siltuximab.Approved
ValdecoxibThe serum concentration of Valdecoxib can be decreased when it is combined with Siltuximab.Investigational, Withdrawn
VandetanibThe serum concentration of Vandetanib can be decreased when it is combined with Siltuximab.Approved
VanoxerineThe serum concentration of Vanoxerine can be decreased when it is combined with Siltuximab.Investigational
VardenafilThe serum concentration of Vardenafil can be decreased when it is combined with Siltuximab.Approved
VemurafenibThe serum concentration of Vemurafenib can be decreased when it is combined with Siltuximab.Approved
VenetoclaxThe serum concentration of Venetoclax can be decreased when it is combined with Siltuximab.Approved
VenlafaxineThe serum concentration of Venlafaxine can be decreased when it is combined with Siltuximab.Approved
VerapamilThe serum concentration of Verapamil can be decreased when it is combined with Siltuximab.Approved
VilanterolThe serum concentration of Vilanterol can be decreased when it is combined with Siltuximab.Approved
VilazodoneThe serum concentration of Vilazodone can be decreased when it is combined with Siltuximab.Approved
VinblastineThe serum concentration of Vinblastine can be decreased when it is combined with Siltuximab.Approved
VincristineThe serum concentration of Vincristine can be decreased when it is combined with Siltuximab.Approved, Investigational
VindesineThe serum concentration of Vindesine can be decreased when it is combined with Siltuximab.Approved
VinorelbineThe serum concentration of Vinorelbine can be decreased when it is combined with Siltuximab.Approved, Investigational
VismodegibThe serum concentration of Vismodegib can be decreased when it is combined with Siltuximab.Approved
VoriconazoleThe serum concentration of Voriconazole can be decreased when it is combined with Siltuximab.Approved, Investigational
VortioxetineThe serum concentration of Vortioxetine can be decreased when it is combined with Siltuximab.Approved
WarfarinThe serum concentration of Warfarin can be decreased when it is combined with Siltuximab.Approved
YohimbineThe serum concentration of Yohimbine can be decreased when it is combined with Siltuximab.Approved, Vet Approved
ZafirlukastThe serum concentration of Zafirlukast can be decreased when it is combined with Siltuximab.Approved, Investigational
ZalcitabineThe serum concentration of Zalcitabine can be decreased when it is combined with Siltuximab.Approved
ZaleplonThe serum concentration of Zaleplon can be decreased when it is combined with Siltuximab.Approved, Illicit, Investigational
ZidovudineThe serum concentration of Zidovudine can be decreased when it is combined with Siltuximab.Approved
ZileutonThe serum concentration of Zileuton can be decreased when it is combined with Siltuximab.Approved, Investigational, Withdrawn
ZiprasidoneThe serum concentration of Ziprasidone can be decreased when it is combined with Siltuximab.Approved
ZolpidemThe serum concentration of Zolpidem can be decreased when it is combined with Siltuximab.Approved
ZomepiracThe serum concentration of Zomepirac can be decreased when it is combined with Siltuximab.Withdrawn
ZonisamideThe serum concentration of Zonisamide can be decreased when it is combined with Siltuximab.Approved, Investigational
ZopicloneThe serum concentration of Zopiclone can be decreased when it is combined with Siltuximab.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Puchalski T, Prabhakar U, Jiao Q, Berns B, Davis HM: Pharmacokinetic and pharmacodynamic modeling of an anti-interleukin-6 chimeric monoclonal antibody (siltuximab) in patients with metastatic renal cell carcinoma. Clin Cancer Res. 2010 Mar 1;16(5):1652-61. doi: 10.1158/1078-0432.CCR-09-2581. Epub 2010 Feb 23. [PubMed:20179212 ]
  2. Deisseroth A, Ko CW, Nie L, Zirkelbach JF, Zhao L, Bullock J, Mehrotra N, Del Valle P, Saber H, Sheth C, Gehrke B, Justice R, Farrell A, Pazdur R: FDA approval: siltuximab for the treatment of patients with multicentric Castleman disease. Clin Cancer Res. 2015 Mar 1;21(5):950-4. doi: 10.1158/1078-0432.CCR-14-1678. Epub 2015 Jan 19. [PubMed:25601959 ]
  3. Liu YC, Stone K, van Rhee F: Siltuximab for multicentric Castleman disease. Expert Rev Hematol. 2014 Oct;7(5):545-57. doi: 10.1586/17474086.2014.946402. Epub 2014 Aug 9. [PubMed:25110138 ]
External Links
ATC CodesL04AC11 — Siltuximab
AHFS Codes
  • 10:00
PDB EntriesNot Available
FDA labelDownload (326 KB)
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingBasic ScienceDiabetes, Diabetes Mellitus Type 11
0WithdrawnTreatmentAgnogenic Myeloid Metaplasia / Polycythemia Vera (PV) / Primary Myelofibrosis / Thrombocytopenias1
1CompletedTreatmentGiant Lymph Node Hyperplasia / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentHealthy Volunteers1
1CompletedTreatmentMonoclonal Gammopathy of Undetermined Significance (MGUS) / Multiple Myeloma (MM) / Plasma Cell Neoplasms1
1CompletedTreatmentProstatic Neoplasms1
1TerminatedTreatmentMultiple Myeloma (MM)1
1, 2CompletedTreatmentNeoplasms, Colorectal / Neoplasms, Head and Neck / Neoplasms, Lung / Neoplasms, Ovarian / Neoplasms, Pancreatic1
1, 2CompletedTreatmentPlasma Cell Myeloma1
1, 2CompletedTreatmentRenal Cell Adenocarcinoma1
1, 2RecruitingTreatmentPsychotic Disorder NOS / Schizophrenic Disorders1
2Active Not RecruitingTreatmentHigh-risk Smoldering Multiple Myeloma1
2Active Not RecruitingTreatmentMulticentric Castleman's Disease2
2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentMalignant Neoplasm of Prostate1
2CompletedTreatmentMultiple Myeloma (MM)2
2TerminatedTreatmentMalignant Neoplasm of Prostate1
2TerminatedTreatmentMyelodysplastic Syndrome1
2WithdrawnTreatmentRenal Cancers1
3WithdrawnTreatmentMultiple Myeloma (MM)1
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionIntravenous100 mg/1
Injection, powder, lyophilized, for solutionIntravenous400 mg/1
Powder, for solutionIntravenous100 mg
Powder, for solutionIntravenous400 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US7612182 No2007-08-012027-08-01Us
Properties
StateSolid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonistantibody
General Function:
Interleukin-6 receptor binding
Specific Function:
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as ...
Gene Name:
IL6
Uniprot ID:
P05231
Molecular Weight:
23717.965 Da
References
  1. van Zaanen HC, Koopmans RP, Aarden LA, Rensink HJ, Stouthard JM, Warnaar SO, Lokhorst HM, van Oers MH: Endogenous interleukin 6 production in multiple myeloma patients treated with chimeric monoclonal anti-IL6 antibodies indicates the existence of a positive feed-back loop. J Clin Invest. 1996 Sep 15;98(6):1441-8. [PubMed:8823310 ]
Drug created on March 16, 2015 13:35 / Updated on August 17, 2016 12:24