Glutamate receptor ionotropic, NMDA 2D

Details

Name
Glutamate receptor ionotropic, NMDA 2D
Synonyms
  • EB11
  • GluN2D
  • Glutamate [NMDA] receptor subunit epsilon-4
  • N-methyl D-aspartate receptor subtype 2D
  • NMDAR2D
  • NR2D
Gene Name
GRIN2D
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016080|Glutamate receptor ionotropic, NMDA 2D
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE
AAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADG
FHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPP
AGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAG
GTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYP
YAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHD
GLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDL
GTRRGSAHFSSLESEV
Number of residues
1336
Molecular Weight
143750.685
Theoretical pI
8.27
GO Classification
Functions
extracellular-glutamate-gated ion channel activity / NMDA glutamate receptor activity
Processes
activation of MAPKK activity / adult locomotory behavior / axon guidance / epidermal growth factor receptor signaling pathway / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / innate immune response / insulin receptor signaling pathway / ion transmembrane transport / ionotropic glutamate receptor signaling pathway / MAPK cascade / neurotrophin TRK receptor signaling pathway / Ras protein signal transduction / regulation of sensory perception of pain / signal transduction / small GTPase mediated signal transduction / startle response / synaptic transmission / synaptic transmission, glutamatergic / vascular endothelial growth factor receptor signaling pathway
Components
cell junction / dendrite / intracellular / NMDA selective glutamate receptor complex / plasma membrane / postsynaptic membrane
General Function
Nmda glutamate receptor activity
Specific Function
NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
Pfam Domain Function
Transmembrane Regions
584-604 657-677 845-865
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016081|Glutamate receptor ionotropic, NMDA 2D (GRIN2D)
ATGCGCGGCGCCGGTGGCCCCCGCGGCCCTCGGGGCCCCGCTAAGATGCTGCTGCTGCTG
GCGCTGGCCTGCGCCAGCCCGTTCCCGGAGGAGGCGCCGGGGCCGGGCGGGGCCGGTGGG
CCCGGCGGCGGCCTCGGCGGGGCGCGGCCGCTCAACGTGGCGCTCGTGTTCTCGGGGCCC
GCGTACGCGGCCGAGGCGGCACGCCTGGGCCCGGCCGTGGCGGCGGCGGTGCGCAGCCCG
GGCCTAGACGTGCGGCCCGTGGCGCTGGTGCTCAACGGCTCGGACCCGCGCAGCCTCGTG
CTGCAGCTCTGCGACCTGCTGTCGGGGTTGCGCGTGCACGGCGTGGTCTTCGAAGACGAC
TCGCGCGCGCCCGCCGTCGCGCCCATCCTCGACTTCCTGTCGGCGCAGACCTCGCTGCCC
ATCGTGGCCGTGCACGGCGGCGCCGCGCTCGTGCTCACGCCCAAGGAGAAGGGCTCCACC
TTCCTGCAGCTGGGCTCTTCCACCGAGCAACAGCTTCAGGTCATCTTTGAGGTGCTGGAG
GAGTATGACTGGACGTCCTTTGTAGCCGTGACCACTCGTGCCCCTGGCCACCGGGCCTTC
CTGTCCTACATTGAGGTGCTGACTGACGGTAGTCTGGTGGGCTGGGAGCACCGCGGAGCG
CTGACGCTGGACCCTGGGGCGGGCGAGGCCGTGCTCAGTGCCCAGCTCCGCAGTGTCAGC
GCGCAGATCCGCCTGCTCTTCTGCGCCCGAGAGGAGGCCGAGCCCGTGTTCCGCGCAGCT
GAGGAGGCTGGCCTCACTGGATCTGGCTACGTCTGGTTCATGGTGGGGCCCCAGCTGGCT
GGAGGCGGGGGCTCTGGGGCCCCTGGTGAGCCCCCTCTTCTGCCAGGAGGCGCCCCCCTG
CCTGCCGGGCTGTTTGCAGTGCGCTCGGCTGGCTGGCGGGATGACCTGGCTCGGCGAGTG
GCAGCTGGCGTGGCCGTAGTGGCCAGAGGTGCCCAGGCCCTGCTGCGTGATTATGGTTTC
CTTCCTGAGCTCGGCCACGACTGTCGCGCCCAGAACCGCACCCACCGCGGCGAGAGTCTG
CATAGGTACTTCATGAACATCACGTGGGATAACCGGGATTACTCCTTCAATGAGGACGGC
TTCCTAGTGAACCCCTCCCTGGTGGTCATCTCCCTCACCAGAGACAGGACGTGGGAGGTG
GTGGGCAGCTGGGAGCAGCAGACGCTCCGCCTCAAGTACCCGCTGTGGTCCCGCTATGGT
CGCTTCCTGCAGCCAGTGGACGACACGCAGCACCTCACGGTGGCCACGCTGGAGGAAAGG
CCGTTTGTCATCGTGGAGCCTGCAGACCCTATCAGCGGCACCTGCATCCGAGACTCCGTC
CCCTGCCGGAGCCAGCTCAACCGAACCCACAGCCCTCCACCGGATGCCCCCCGCCCGGAA
AAGCGCTGCTGCAAGGGTTTCTGCATCGACATTCTGAAGCGGCTGGCGCATACCATCGGC
TTCAGCTACGACCTCTACCTGGTCACCAATGGCAAGCACGGAAAGAAGATCGATGGCGTC
TGGAACGGCATGATCGGGGAGGTGTTCTACCAGCGCGCAGACATGGCCATCGGCTCCCTC
ACCATCAACGAGGAGCGCTCCGAGATCGTGGACTTCTCCGTCCCCTTCGTGGAGACCGGC
ATCAGCGTCATGGTGGCGCGCAGCAATGGCACGGTGTCCCCCTCGGCCTTCCTCGAGCCC
TACAGCCCCGCCGTGTGGGTGATGATGTTCGTCATGTGCCTCACTGTGGTCGCCGTCACT
GTTTTCATCTTCGAGTACCTCAGTCCTGTTGGTTACAACCGCAGCCTGGCCACGGGCAAG
CGCCCTGGCGGTTCAACCTTCACCATTGGGAAATCCATCTGGCTGCTCTGGGCCCTGGTG
TTCAATAATTCGGTGCCCGTGGAGAACCCCCGGGGAACCACCAGCAAAATCATGGTGCTG
GTGTGGGCCTTCTTCGCCGTCATCTTCCTCGCCAGCTACACAGCCAACCTGGCCGCCTTC
ATGATCCAGGAGGAGTACGTGGATACTGTGTCTGGGCTCAGTGACCGCAAGTTCCAGAGG
CCCCAGGAGCAGTACCCGCCCCTGAAGTTTGGGACCGTGCCCAACGGCTCCACGGAGAAG
AACATCCGCAGCAACTATCCCGACATGCACAGCTACATGGTGCGCTACAACCAGCCCCGC
GTAGAGGAAGCGCTCACTCAGCTCAAGGCAGGGAAGCTGGACGCCTTCATCTACGATGCT
GCAGTGCTCAATTACATGGCCCGCAAGGACGAGGGCTGCAAGCTTGTCACCATCGGCTCC
GGCAAGGTCTTCGCCACGACAGGCTATGGCATCGCCCTGCACAAGGGCTCCCGCTGGAAG
CGGCCCATCGACCTGGCGTTGCTGCAGTTCCTGGGGGATGATGAGATCGAGATGCTGGAG
CGGCTGTGGCTCTCTGGGATCTGCCACAATGACAAAATCGAGGTGATGAGCAGCAAGCTG
GACATCGACAACATGGCGGGCGTCTTCTACATGCTCCTGGTGGCCATGGGCCTGTCCCTG
CTGGTCTTCGCCTGGGAGCACCTGGTGTACTGGCGCCTGCGGCACTGCCTGGGGCCCACC
CACCGCATGGACTTCCTGCTGGCCTTCTCCAGGGGCATGTACAGCTGCTGCAGCGCTGAG
GCCGCCCCACCGCCCGCCAAGCCCCCGCCGCCGCCACAGCCCCTGCCCAGCCCCGCGTAC
CCCGCGCCGCGGCCGGCTCCCGGGCCCGCACCTTTCGTGCCCCGCGAGCGCGCCTCAGTG
GACCGCTGGCGCCGGACCAAGGGCGCGGGGCCGCCGGGGGGCGCGGGCCTGGCCGACGGC
TTCCACCGCTACTACGGCCCCATCGAGCCGCAGGGCCTAGGCCTCGGCCTGGGCGAAGCG
CGCGCGGCACCGCGGGGCGCAGCCGGGCGCCCGCTGTCCCCGCCGGCCGCTCAGCCCCCG
CAGAAGCCGCCGCCCTCCTATTTCGCCATCGTACGCGACAAGGAGCCAGCCGAGCCCCCC
GCCGGCGCCTTCCCCGGCTTCCCGTCGCCGCCCGCGCCCCCCGCCGCCGCGGCCACCGCC
GTCGGGCCGCCACTCTGCCGCTTGGCCTTCGAGGACGAGAGCCCGCCGGCGCCCGCGCGG
TGGCCGCGCTCGGACCCCGAGAGCCAACCCCTGCTGGGGCCAGGCGCGGGCGGCGCGGGG
GGCACGGGGGGCGCAGGCGGAGGAGCCCCGGCCGCTCCGCCCCCGTGCCGCGCCGCGCCG
CCCCCGTGCCCTTACCTCGATCTCGAGCCGTCGCCGTCGGACTCGGAGGACTCGGAGAGC
CTGGGCGGCGCGTCGCTGGGCGGCCTGGAGCCCTGGTGGTTCGCCGACTTCCCTTACCCG
TATGCCGAGCGCCTCGGGCCGCCGCCCGGCCGCTACTGGTCGGTCGACAAGCTCGGGGGC
TGGCGCGCCGGGAGCTGGGACTACCTGCCCCCGCGCAGCGGTCCGGCCGCCTGGCACTGT
CGGCACTGCGCCAGCCTGGAGCTGCTGCCGCCGCCGCGCCATCTCAGCTGCTCGCACGAT
GGCCTGGACGGCGGCTGGTGGGCGCCACCGCCTCCACCCTGGGCCGCCGGGCCCCTGCCC
CGACGCCGGGCCCGCTGCGGGTGCCCGCGGTCGCACCCGCACCGCCCGCGGGCCTCGCAC
CGCACGCCCGCCGCCGCCGCGCCCCACCACCACAGGCACCGGCGCGCCGCTGGGGGCTGG
GACCTCCCGCCGCCCGCGCCCACCTCGCGCTCGCTCGAGGACCTCAGCTCGTGCCCTCGC
GCCGCCCCTGCGCGCAGGCTTACCGGGCCCTCCCGCCACGCTCGCAGGTGTCCGCACGCC
GCGCACTGGGGGCCGCCGCTGCCCACAGCTTCCCACCGGAGACACCGGGGCGGGGACCTG
GGCACCCGCAGGGGCTCGGCGCACTTCTCTAGCCTCGAGTCCGAGGTATGA
Chromosome Location
19
Locus
19q13.1-qter
External Identifiers
ResourceLink
UniProtKB IDO15399
UniProtKB Entry NameNMDE4_HUMAN
GenBank Protein ID2444026
GenBank Gene IDU77783
GenAtlas IDGRIN2D
HGNC IDHGNC:4588
General References
  1. Hess SD, Daggett LP, Deal C, Lu CC, Johnson EC, Velicelebi G: Functional characterization of human N-methyl-D-aspartate subtype 1A/2D receptors. J Neurochem. 1998 Mar;70(3):1269-79. [PubMed:9489750]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01173OrphenadrineapprovedyesantagonistDetails
DB00142Glutamic Acidapproved, nutraceuticalunknownDetails
DB01520Tenocyclidineexperimental, illicit, investigationalunknownantagonistDetails
DB00454MeperidineapprovedunknownantagonistDetails
DB06151Acetylcysteineapproved, investigationalunknownactivatorDetails
DB00659Acamprosateapproved, investigationalyesantagonistDetails
DB06741GavestinelinvestigationalunknownantagonistDetails
DB09481Magnesium carbonateapproved, investigationalunknownblockerDetails
DB09409Magnesium acetate tetrahydrateapprovedunknownligandDetails
DB13146Fluciclovine (18F)approvednoinhibitorDetails
DB01043Memantineapproved, investigationalyesantagonistDetails
DB04896Milnacipranapproved, investigationalunknowninhibitorDetails
DB00289AtomoxetineapprovedunknownblockerDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedunknownantagonistDetails
DB00418Secobarbitalapproved, vet_approvedunknownantagonistDetails
DB00996Gabapentinapproved, investigationalunknowninhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknownantagonistDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownagonistDetails
DB06738KetobemidoneinvestigationalunknownantagonistDetails
DB11823Esketamineapproved, investigationalunknownantagonistDetails
DB00874Guaifenesinapproved, investigational, vet_approvedunknownantagonistDetails