You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameHyaluronidase
Accession NumberDB00070  (BIOD00022, BTD00022)
TypeBiotech
GroupsApproved, Investigational
Description

Highly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.

Protein structureDb00070
Protein chemical formulaC2455H3775N617O704S21
Protein average weight53870.9000
Sequences
> Hyaluronidase Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
Download FASTA Format
Synonyms
SynonymLanguageCode
HYAL-1Not AvailableNot Available
Hyaluronidase 1 precursorNot AvailableNot Available
Hyaluronidase PH-20Not AvailableNot Available
Sperm adhesion molecule 1Not AvailableNot Available
Sperm surface protein PH-20Not AvailableNot Available
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Amphadaseinjection150 [USP'U]/mLsubcutaneousAmphastar Pharmaceuticals, Inc.2004-10-26Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Vitraseinjection, solution200 [USP&apos'U]/mLsubcutaneousBausch & Lomb Incorporated2005-02-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Vitraseinjection, solution200 [USP&apos'U]/mLsubcutaneousBausch & Lomb Incorporated2005-02-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Vitraseinjection, solution200 [USP'U]/mLsubcutaneousISTA Pharmaceuticals, Inc.2005-02-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Generic Prescription ProductsNot Available
Over the Counter ProductsNot Available
International Brands
NameCompany
VitraganNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
CAS number488712-31-8
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor increase of absorption and distribution of other injected drugs and for rehydration.
PharmacodynamicsHyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.
Mechanism of actionHyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Amphastar pharmaceutical inc
  • Primapharm inc
  • Ista pharmaceuticals
  • Baxter healthcare corp anesthesia and critical care
Packagers
Dosage forms
FormRouteStrength
Injectionsubcutaneous150 [USP'U]/mL
Injection, solutionsubcutaneous200 [USP&apos'U]/mL
Injection, solutionsubcutaneous200 [USP'U]/mL
Prices
Unit descriptionCostUnit
Vitrasert 4.5 mg implant19200.0USD implant
Vitrase 6200 unit vial967.2USD vial
Hyaluronidase powder900.0USD g
Hylenex 150 unit/ml vial108.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.117Not Available
isoelectric point5.73Not Available
References
Synthesis Reference

Yasuhiro Mima, Masaaki Yamada, “Preparation of human placental hyaluronidase.” U.S. Patent US3945889, issued October, 1957.

US3945889
General Reference
  1. Csoka AB, Scherer SW, Stern R: Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31. Genomics. 1999 Sep 15;60(3):356-61. Pubmed
External Links
ATC CodesB06AA03
AHFS CodesNot Available
PDB Entries
FDA labelDownload (42.5 KB)
MSDSDownload (72.5 KB)
Interactions
Drug Interactions
Drug
Acetylsalicylic acidMay diminish the therapeutic effect of Hyaluronidase.
AlclometasoneMay diminish the therapeutic effect of Hyaluronidase.
AmcinonideMay diminish the therapeutic effect of Hyaluronidase.
Aminosalicylic AcidSalicylates may diminish the therapeutic effect of Hyaluronidase.
ArticaineMay enhance the vasoconstricting effect of Alpha-/Beta-Agonists.
AzelastineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
BeclomethasoneMay diminish the therapeutic effect of Hyaluronidase.
BetamethasoneMay diminish the therapeutic effect of Hyaluronidase.
Bismuth SubsalicylateSalicylates may diminish the therapeutic effect of Hyaluronidase.
BrompheniramineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
BudesonideMay diminish the therapeutic effect of Hyaluronidase.
BupivacaineMay enhance the adverse/toxic effect of Local Anesthetics.
CalcipotriolCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
CarbinoxamineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
CetirizineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
ChloroprocaineMay enhance the adverse/toxic effect of Local Anesthetics.
ChlorphenamineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
ClemastineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
Clobetasol propionateMay diminish the therapeutic effect of Hyaluronidase.
ClocortoloneMay diminish the therapeutic effect of Hyaluronidase.
CorticotropinCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
Cortisone acetateMay diminish the therapeutic effect of Hyaluronidase.
CyclizineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
CyproheptadineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
DesloratadineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
DesogestrelEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
DesoximetasoneCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
DexbrompheniramineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
DiflorasoneCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
DifluprednateMay diminish the therapeutic effect of Hyaluronidase.
DimenhydrinateAntihistamines may diminish the therapeutic effect of Hyaluronidase.
DopamineHyaluronidase may enhance the adverse/toxic effect of DOPamine.
DoxylamineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
DrospirenoneEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
EstropipateEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
Ethinyl EstradiolEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
EthynodiolEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
FexofenadineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
FludrocortisoneCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
Fluocinolone AcetonideCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
FluocinonideCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
FluorometholoneCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
FlurandrenolideCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
Fluticasone furoateMay diminish the therapeutic effect of Hyaluronidase.
Fluticasone PropionateAntihistamines may diminish the therapeutic effect of Hyaluronidase.
HalcinonideMay diminish the therapeutic effect of Hyaluronidase.
Halobetasol PropionateCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
HydrocortamateMay diminish the therapeutic effect of Hyaluronidase.
HydroxyzineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
KetotifenAntihistamines may diminish the therapeutic effect of Hyaluronidase.
LevocabastineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
LevocetirizineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
LevonordefrinMay enhance the vasoconstricting effect of Alpha-/Beta-Agonists.
LoratadineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
Magnesium salicylateSalicylates may diminish the therapeutic effect of Hyaluronidase.
MeclizineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
MepivacaineMay enhance the adverse/toxic effect of Local Anesthetics.
MestranolEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
MethylprednisoloneCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
NorelgestrominEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
NorepinephrineMay enhance the vasoconstricting effect of Alpha-/Beta-Agonists.
NorgestimateEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
OlopatadineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
PiperazineEstrogen Derivatives may diminish the therapeutic effect of Hyaluronidase.
PizotifenAntihistamines may diminish the therapeutic effect of Hyaluronidase.
PrednicarbateMay diminish the therapeutic effect of Hyaluronidase.
PrednisoneCorticosteroids may diminish the therapeutic effect of Hyaluronidase.
PrilocaineMay enhance the adverse/toxic effect of Local Anesthetics.
RimexoloneMay diminish the therapeutic effect of Hyaluronidase.
RopivacaineMay enhance the adverse/toxic effect of Local Anesthetics.
Salicylate-sodiumMay diminish the therapeutic effect of Hyaluronidase.
SalsalateSalicylates may diminish the therapeutic effect of Hyaluronidase.
TriprolidineAntihistamines may diminish the therapeutic effect of Hyaluronidase.
Food InteractionsNot Available

Targets

1. Hyaluronan

Kind: small molecule

Organism: Human

Pharmacological action: yes

Actions: other

Components

Name UniProt ID Details

References:

  1. Nelson, D.L., & Cox, M.M. (2005). Lehninger principles of biochemistry (4 th ed). New York, NY: W.H. Freeman and Company. doi:10.1002/bmb.2005.494033010419

2. Transforming growth factor beta-1

Kind: protein

Organism: Human

Pharmacological action: unknown

Actions: inhibitor

Components

Name UniProt ID Details
Transforming growth factor beta-1 P01137 Details

References:

  1. Chang NS: Hyaluronidase activation of c-Jun N-terminal kinase is necessary for protection of L929 fibrosarcoma cells from staurosporine-mediated cell death. Biochem Biophys Res Commun. 2001 May 4;283(2):278-86. Pubmed
  2. Locci P, Marinucci L, Lilli C, Martinese D, Becchetti E: Transforming growth factor beta 1-hyaluronic acid interaction. Cell Tissue Res. 1995 Aug;281(2):317-24. Pubmed
  3. Chang NS: Hyaluronidase enhancement of TNF-mediated cell death is reversed by TGF-beta 1. Am J Physiol. 1997 Dec;273(6 Pt 1):C1987-94. Pubmed
  4. Chang NS: Transforming growth factor-beta protection of cancer cells against tumor necrosis factor cytotoxicity is counteracted by hyaluronidase (review). Int J Mol Med. 1998 Dec;2(6):653-9. Pubmed

Carriers

1. Serum albumin

Kind: protein

Organism: Human

Pharmacological action: unknown

Actions: inhibitor

Components

Name UniProt ID Details
Serum albumin P02768 Details

References:

  1. Maingonnat C, Victor R, Bertrand P, Courel MN, Maunoury R, Delpech B: Activation and inhibition of human cancer cell hyaluronidase by proteins. Anal Biochem. 1999 Mar 1;268(1):30-4. Pubmed
  2. Parameswaran S, Brown LV, Ibbott GS, Lai-Fook SJ: Effect of concentration and hyaluronidase on albumin diffusion across rabbit mesentery. Microcirculation. 1999 Jun;6(2):117-26. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on December 02, 2014 16:33