You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameHyaluronidase
Accession NumberDB00070  (BIOD00022, BTD00022)
Typebiotech
Groupsapproved, investigational
Description

Highly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.

Protein structureDb00070
Protein chemical formulaC2455H3775N617O704S21
Protein average weight53870.9000
Sequences
> Hyaluronidase Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
Download FASTA Format
Synonyms
SynonymLanguageCode
HYAL-1Not AvailableNot Available
Hyaluronidase 1 precursorNot AvailableNot Available
Hyaluronidase PH-20Not AvailableNot Available
Sperm adhesion molecule 1Not AvailableNot Available
Sperm surface protein PH-20Not AvailableNot Available
SaltsNot Available
Brand names
NameCompany
VitraganNot Available
VitraseIsta Pharma
Brand mixturesNot Available
Categories
CAS number488712-31-8
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationFor increase of absorption and distribution of other injected drugs and for rehydration.
PharmacodynamicsHyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.
Mechanism of actionHyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Amphastar pharmaceutical inc
  • Primapharm inc
  • Ista pharmaceuticals
  • Baxter healthcare corp anesthesia and critical care
Packagers
Dosage formsNot Available
Prices
Unit descriptionCostUnit
Vitrasert 4.5 mg implant19200.0USDimplant
Vitrase 6200 unit vial967.2USDvial
Hyaluronidase powder900.0USDg
Hylenex 150 unit/ml vial108.0USDml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
Stateliquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.117Not Available
isoelectric point5.73Not Available
References
Synthesis Reference

Yasuhiro Mima, Masaaki Yamada, “Preparation of human placental hyaluronidase.” U.S. Patent US3945889, issued October, 1957.

US3945889
General Reference
  1. Csoka AB, Scherer SW, Stern R: Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31. Genomics. 1999 Sep 15;60(3):356-61. Pubmed
External Links
ResourceLink
UniProtP38567
GenbankL13781
PharmGKBPA164745713
Drug Product Database2041278
RxListhttp://www.rxlist.com/cgi/generic/hylenex.htm
Drugs.comhttp://www.drugs.com/cdi/hyaluronidase.html
WikipediaHyaluronidase
ATC CodesB06AA03
AHFS CodesNot Available
PDB Entries
FDA labelshow(42.5 KB)
MSDSshow(72.5 KB)
Interactions
Drug InteractionsSearched, but no interactions found.
Food InteractionsNot Available

Targets

1. Hyaluronan

Kind: small molecule

Organism: Human

Pharmacological action: yes

Actions: other

Components

Name UniProt ID Details

References:

  1. Nelson, D.L., & Cox, M.M. (2005). Lehninger principles of biochemistry (4 th ed). New York, NY: W.H. Freeman and Company. doi:10.1002/bmb.2005.494033010419

2. Transforming growth factor beta-1

Kind: protein

Organism: Human

Pharmacological action: unknown

Actions: inhibitor

Components

Name UniProt ID Details
Transforming growth factor beta-1 P01137 Details

References:

  1. Chang NS: Hyaluronidase activation of c-Jun N-terminal kinase is necessary for protection of L929 fibrosarcoma cells from staurosporine-mediated cell death. Biochem Biophys Res Commun. 2001 May 4;283(2):278-86. Pubmed
  2. Locci P, Marinucci L, Lilli C, Martinese D, Becchetti E: Transforming growth factor beta 1-hyaluronic acid interaction. Cell Tissue Res. 1995 Aug;281(2):317-24. Pubmed
  3. Chang NS: Hyaluronidase enhancement of TNF-mediated cell death is reversed by TGF-beta 1. Am J Physiol. 1997 Dec;273(6 Pt 1):C1987-94. Pubmed
  4. Chang NS: Transforming growth factor-beta protection of cancer cells against tumor necrosis factor cytotoxicity is counteracted by hyaluronidase (review). Int J Mol Med. 1998 Dec;2(6):653-9. Pubmed

Carriers

1. Serum albumin

Kind: protein

Organism: Human

Pharmacological action: unknown

Actions: inhibitor

Components

Name UniProt ID Details
Serum albumin P02768 Details

References:

  1. Maingonnat C, Victor R, Bertrand P, Courel MN, Maunoury R, Delpech B: Activation and inhibition of human cancer cell hyaluronidase by proteins. Anal Biochem. 1999 Mar 1;268(1):30-4. Pubmed
  2. Parameswaran S, Brown LV, Ibbott GS, Lai-Fook SJ: Effect of concentration and hyaluronidase on albumin diffusion across rabbit mesentery. Microcirculation. 1999 Jun;6(2):117-26. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on September 13, 2013 10:49