You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameHyaluronidase
Accession NumberDB00070  (BTD00022, BIOD00022)
TypeBiotech
GroupsApproved, Investigational
DescriptionHighly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.
Protein structureDb00070
Related Articles
Protein chemical formulaC2455H3775N617O704S21
Protein average weight53870.9 Da
Sequences
> Hyaluronidase Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
Download FASTA Format
Synonyms
HYAL-1
Hyaluronidase (glycoprotein, sheep testis isoenzyme)
Hyaluronidase (ovine)
Hyaluronidase (sheep testis isoenzyme)
Hyaluronidase 1 precursor
Hyaluronidase PH-20
Hyaluronidase, ovine
Ovine hyaluronidase
Sperm adhesion molecule 1
Sperm surface protein PH-20
External Identifiers
  • HYO6A
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Amphadaseinjection150 [USP'U]/mLsubcutaneousAmphastar Pharmaceuticals, Inc.2004-10-26Not applicableUs
Hydaseinjection, solution150 [USP'U]/mLinfiltration; interstitial; intramuscular; intraocular; retrobulbar; subcutaneousAkorn, Inc.2015-11-05Not applicableUs
Vitraseinjection, solution200 [USP'U]/mLsubcutaneousBausch & Lomb Incorporated2005-02-01Not applicableUs
Vitraseinjection, solution200 [USP'U]/mLsubcutaneousISTA Pharmaceuticals, Inc.2005-02-01Not applicableUs
Wydase Inj 150unit/mlliquid150 unitblock/infiltration; subcutaneous; surgicalWyeth Ltd.1954-12-311996-09-10Canada
Wydase Injection Liq 150 Units/mlliquid150 unitblock/infiltration; subcutaneousWyeth Ayerst Canada Inc.1994-12-312002-06-10Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
VitraganNot Available
Brand mixtures
NameLabellerIngredients
HyqviaBaxalta Us Inc.
SaltsNot Available
Categories
UNII64R4OHP8T0
CAS number488712-31-8
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor increase of absorption and distribution of other injected drugs and for rehydration.
PharmacodynamicsHyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.
Mechanism of actionHyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Amphastar pharmaceutical inc
  • Primapharm inc
  • Ista pharmaceuticals
  • Baxter healthcare corp anesthesia and critical care
Packagers
Dosage forms
FormRouteStrength
Injectionsubcutaneous150 [USP'U]/mL
Injection, solutioninfiltration; interstitial; intramuscular; intraocular; retrobulbar; subcutaneous150 [USP'U]/mL
Kit
Injection, solutionsubcutaneous200 [USP'U]/mL
Liquidblock/infiltration; subcutaneous; surgical150 unit
Liquidblock/infiltration; subcutaneous150 unit
Prices
Unit descriptionCostUnit
Vitrasert 4.5 mg implant19200.0USD implant
Vitrase 6200 unit vial967.2USD vial
Hyaluronidase powder900.0USD g
Hylenex 150 unit/ml vial108.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.117Not Available
isoelectric point5.73Not Available
References
Synthesis Reference

Yasuhiro Mima, Masaaki Yamada, “Preparation of human placental hyaluronidase.” U.S. Patent US3945889, issued October, 1957.

US3945889
General References
  1. Csoka AB, Scherer SW, Stern R: Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31. Genomics. 1999 Sep 15;60(3):356-61. [PubMed:10493834 ]
External Links
ATC CodesB06AA03
AHFS CodesNot Available
PDB Entries
FDA labelDownload (42.5 KB)
MSDSDownload (72.5 KB)
Interactions
Drug Interactions
Drug
4-AndrostenedioneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with 4-Androstenedione.
Acetylsalicylic acidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Acetylsalicylic acid.
AcrivastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Acrivastine.
AlcaftadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Alcaftadine.
AlclometasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Alclometasone.
AldosteroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Aldosterone.
AlimemazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Alimemazine.
AmcinonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Amcinonide.
Aminosalicylic AcidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Aminosalicylic Acid.
AntazolineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Antazoline.
ArticaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Articaine.
AstemizoleThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Astemizole.
AzatadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Azatadine.
AzelastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Azelastine.
BazedoxifeneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Bazedoxifene.
Beclomethasone dipropionateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Beclomethasone dipropionate.
BenzocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Benzocaine.
Benzyl alcoholThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Benzyl alcohol.
BetamethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Betamethasone.
BrompheniramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Brompheniramine.
BuclizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Buclizine.
BudesonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Budesonide.
BupivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Bupivacaine.
ButacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Butacaine.
ButambenThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Butamben.
Butanoic AcidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Butanoic Acid.
CapsaicinThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Capsaicin.
CarbinoxamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Carbinoxamine.
CetirizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cetirizine.
ChloroprocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Chloroprocaine.
ChloropyramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chloropyramine.
ChlorotrianiseneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chlorotrianisene.
ChlorphenamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chlorphenamine.
ChlorphenoxamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chlorphenoxamine.
CiclesonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ciclesonide.
CimetidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cimetidine.
CinchocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Cinchocaine.
CinnarizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cinnarizine.
ClemastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Clemastine.
Clobetasol propionateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Clobetasol propionate.
ClocortoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Clocortolone.
CocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Cocaine.
Conjugated Equine EstrogensThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Conjugated Equine Estrogens.
Cortisone acetateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cortisone acetate.
CyclizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cyclizine.
CyproheptadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cyproheptadine.
DehydroepiandrosteroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dehydroepiandrosterone.
dehydroepiandrosterone sulfateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with dehydroepiandrosterone sulfate.
DesloratadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Desloratadine.
DesoximetasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Desoximetasone.
Desoxycorticosterone acetateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Desoxycorticosterone acetate.
DexamethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexamethasone.
Dexamethasone isonicotinateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexamethasone isonicotinate.
DexbrompheniramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexbrompheniramine.
Dexchlorpheniramine maleateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexchlorpheniramine maleate.
DienestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dienestrol.
DiethylstilbestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diethylstilbestrol.
DiflorasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diflorasone.
DiflunisalThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diflunisal.
DifluocortoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Difluocortolone.
DifluprednateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Difluprednate.
DimenhydrinateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dimenhydrinate.
DimetindeneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dimetindene.
DimetotiazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dimetotiazine.
DiphenhydramineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Diphenhydramine.
DiphenhydramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diphenhydramine.
DopamineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Dopamine.
DoxepinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Doxepin.
DoxylamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Doxylamine.
DyclonineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Dyclonine.
EmedastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Emedastine.
EpinastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Epinastine.
EquileninThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Equilenin.
EquilinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Equilin.
EsmirtazapineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Esmirtazapine.
EstradiolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Estradiol.
EstriolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Estriol.
EstroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Estrone.
Ethinyl EstradiolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ethinyl Estradiol.
EthopropazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ethopropazine.
EtidocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Etidocaine.
FamotidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Famotidine.
FexofenadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fexofenadine.
FludrocortisoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fludrocortisone.
FlumethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flumethasone.
FlunarizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flunarizine.
FlunisolideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flunisolide.
Fluocinolone AcetonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluocinolone Acetonide.
FluocinonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluocinonide.
FluocortoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluocortolone.
FluorometholoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluorometholone.
FluprednideneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluprednidene.
FluprednisoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluprednisolone.
FlurandrenolideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flurandrenolide.
Fluticasone furoateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluticasone furoate.
Fluticasone PropionateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluticasone Propionate.
GenisteinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Genistein.
HexestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Hexestrol.
HydrocortisoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Hydrocortisone.
HydroxyzineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Hydroxyzine.
IsothipendylThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Isothipendyl.
KetotifenThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ketotifen.
LevobupivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Levobupivacaine.
LevocabastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Levocabastine.
LevocetirizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Levocetirizine.
LidocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Lidocaine.
LodoxamideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Lodoxamide.
LoratadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Loratadine.
MeclizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Meclizine.
MedrysoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Medrysone.
MelengestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Melengestrol.
MepivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Mepivacaine.
MepyramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mepyramine.
MequitazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mequitazine.
MesalazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mesalazine.
MestranolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mestranol.
MethapyrileneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Methapyrilene.
MethylprednisoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Methylprednisolone.
MetiamideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Metiamide.
MianserinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mianserin.
MirtazapineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mirtazapine.
MometasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mometasone.
NizatidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Nizatidine.
OlopatadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Olopatadine.
OxybuprocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Oxybuprocaine.
ParamethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Paramethasone.
PemirolastThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Pemirolast.
PhenindamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Phenindamine.
PheniramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Pheniramine.
PhenolThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Phenol.
PhenylephrineHyaluronidase may increase the vasoconstricting activities of Phenylephrine.
Polyestradiol phosphateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Polyestradiol phosphate.
PramocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Pramocaine.
PrednicarbateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Prednicarbate.
PrednisoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Prednisolone.
PrednisoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Prednisone.
PregnenoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Pregnenolone.
PrilocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Prilocaine.
ProcaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Procaine.
PromethazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Promethazine.
ProparacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Proparacaine.
PropoxycaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Propoxycaine.
PSD502The risk or severity of adverse effects can be increased when Hyaluronidase is combined with PSD502.
QuinestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Quinestrol.
RanitidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ranitidine.
RimexoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Rimexolone.
RopivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Ropivacaine.
Roxatidine acetateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Roxatidine acetate.
Salicylic acidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Salicylic acid.
Spaglumic AcidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Spaglumic Acid.
Synthetic Conjugated Estrogens, AThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Synthetic Conjugated Estrogens, A.
Synthetic Conjugated Estrogens, BThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Synthetic Conjugated Estrogens, B.
TerfenadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Terfenadine.
TesmilifeneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tesmilifene.
TetracaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Tetracaine.
TetrodotoxinThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Tetrodotoxin.
ThonzylamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Thonzylamine.
TiboloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tibolone.
TixocortolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tixocortol.
TranilastThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tranilast.
TriamcinoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Triamcinolone.
TripelennamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tripelennamine.
TriprolidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Triprolidine.
ZeranolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Zeranol.
Food InteractionsNot Available

Targets

Kind
Small molecule
Organism
Human
Pharmacological action
yes
Actions
other
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Type iii transforming growth factor beta receptor binding
Specific Function:
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiati...
Gene Name:
TGFB1
Uniprot ID:
P01137
Molecular Weight:
44340.685 Da
References
  1. Chang NS: Hyaluronidase activation of c-Jun N-terminal kinase is necessary for protection of L929 fibrosarcoma cells from staurosporine-mediated cell death. Biochem Biophys Res Commun. 2001 May 4;283(2):278-86. [PubMed:11327694 ]
  2. Locci P, Marinucci L, Lilli C, Martinese D, Becchetti E: Transforming growth factor beta 1-hyaluronic acid interaction. Cell Tissue Res. 1995 Aug;281(2):317-24. [PubMed:7648625 ]
  3. Chang NS: Hyaluronidase enhancement of TNF-mediated cell death is reversed by TGF-beta 1. Am J Physiol. 1997 Dec;273(6 Pt 1):C1987-94. [PubMed:9435505 ]
  4. Chang NS: Transforming growth factor-beta protection of cancer cells against tumor necrosis factor cytotoxicity is counteracted by hyaluronidase (review). Int J Mol Med. 1998 Dec;2(6):653-9. [PubMed:9850732 ]

Carriers

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Toxic substance binding
Specific Function:
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc.
Gene Name:
ALB
Uniprot ID:
P02768
Molecular Weight:
69365.94 Da
References
  1. Maingonnat C, Victor R, Bertrand P, Courel MN, Maunoury R, Delpech B: Activation and inhibition of human cancer cell hyaluronidase by proteins. Anal Biochem. 1999 Mar 1;268(1):30-4. [PubMed:10036158 ]
  2. Parameswaran S, Brown LV, Ibbott GS, Lai-Fook SJ: Effect of concentration and hyaluronidase on albumin diffusion across rabbit mesentery. Microcirculation. 1999 Jun;6(2):117-26. [PubMed:10466114 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23