| Identification | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Hyaluronidase | ||||||||||||||||
| Accession Number | DB00070 (BIOD00022, BTD00022) | ||||||||||||||||
| Type | biotech | ||||||||||||||||
| Groups | approved | ||||||||||||||||
| Description | Highly purified sheep hyaluronidase for administration by injection into the vitreous of the eye. |
||||||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||||||
| Protein chemical formula | C2455H3775N617O704S21 | ||||||||||||||||
| Protein average weight | 53870.9000 | ||||||||||||||||
| Sequences |
>DB00070 sequence LNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDR LGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNLGMAVIDWEEWRPTWA RNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHL WGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAAT LYVRNRVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASG IVIWGTLSIMRSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSS DYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAV DVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLSATMFIVSILFLIISSVASL FASTA |
||||||||||||||||
| Synonyms |
|
||||||||||||||||
| Brand names |
|
||||||||||||||||
| Brand name mixtures | Not Available | ||||||||||||||||
| Categories |
|
||||||||||||||||
| CAS number | 488712-31-8 | ||||||||||||||||
| Taxonomy | |||||||||||||||||
| Kingdom | Not Available | ||||||||||||||||
| Classes | Not Available | ||||||||||||||||
| Substructures | Not Available | ||||||||||||||||
| Pharmacology | |||||||||||||||||
| Indication | For increase of absorption and distribution of other injected drugs and for rehydration. | ||||||||||||||||
| Pharmacodynamics | Hyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs. | ||||||||||||||||
| Mechanism of action | Hyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption. | ||||||||||||||||
| Absorption | Not Available | ||||||||||||||||
| Volume of distribution | Not Available | ||||||||||||||||
| Protein binding | Not Available | ||||||||||||||||
| Metabolism | |||||||||||||||||
| Route of elimination | Not Available | ||||||||||||||||
| Half life | Not Available | ||||||||||||||||
| Clearance | Not Available | ||||||||||||||||
| Toxicity | Not Available | ||||||||||||||||
| Affected organisms |
|
||||||||||||||||
| Pathways | Not Available | ||||||||||||||||
| Pharmacoeconomics | |||||||||||||||||
| Manufacturers |
|
||||||||||||||||
| Packagers |
|
||||||||||||||||
| Dosage forms | Not Available | ||||||||||||||||
| Prices |
|
||||||||||||||||
| Patents | Not Available | ||||||||||||||||
| Properties | |||||||||||||||||
| State | liquid | ||||||||||||||||
| Melting point | Not Available | ||||||||||||||||
| Experimental Properties |
|
||||||||||||||||
| References | |||||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||||
| General Reference |
|
||||||||||||||||
| External Links |
|
||||||||||||||||
| ATC Codes |
|
||||||||||||||||
| AHFS Codes | Not Available | ||||||||||||||||
| PDB Entries | |||||||||||||||||
| FDA label | show (42.5 KB) | ||||||||||||||||
| MSDS | show (72.5 KB) | ||||||||||||||||
| Interactions | |||||||||||||||||
| Drug Interactions |
|
||||||||||||||||
| Food Interactions | Not Available | ||||||||||||||||
| Targets |
|---|
|
Pharmacological action: yes
Actions: other References:
2. Transforming growth factor beta-1 Pharmacological action: unknownActions: inhibitor Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts Organism class: humanUniProt ID: P01137 ![]() Gene: TGFB1 ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Carriers |
|---|
|
Actions: inhibitor
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood UniProt ID: P02768![]() Gene: ALB ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|
This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.