Identification

Name
Insulin Glargine
Accession Number
DB00047  (BTD00045, BIOD00045, DB01308)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones / Insulins
Description

Insulin glargine is produced by recombinant DNA technology using a non-pathogenic laboratory strain of Escherichia coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. Small amounts of insulin glargine are slowly released from microprecipitates giving the drug a long duration of action (up to 24 hours) and no pronounced peak concentration.

Protein structure
Db00047
Protein chemical formula
C267H404N72O78S6
Protein average weight
6063.0 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCG
>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
Download FASTA Format
Synonyms
  • Insulin Glargine (rDNA origin)
  • Insulin glargine recombinant
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarInjection, solution100 Units/mlSubcutaneousEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
International/Other Brands
Lantus OptiSet
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Soliqua 100/33Insulin Glargine (100 U/mL) + Lixisenatide (33 ug/mL)Injection, solutionSubcutaneousSanofi Aventis2016-11-21Not applicableUs
Categories
UNII
2ZM8CX04RZ
CAS number
160337-95-1

Pharmacology

Indication

For the treatment of Type 1 or 2 diabetes mellitus in patients over 17 years old who require a long-acting (basal) insulin for the control of hyperglycemia. May be used in pediatric patients with Type 1 diabetes mellitus who require a long-acting (basal) insulin for glycemic control.

Structured Indications
Pharmacodynamics

Insulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Increased insulin secretion following meals is responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin glargine is a long-acting insulin analogue with a flat and predictable action profile. It is used to mimic the basal levels of insulin in diabetic individuals. The onset of action of insulin glargine is approximately 90 minutes and its duration of action is up to 24 hours. The action profile of insulin glargine is peakless. The significance of this finding is that insulin glargine has a lower chance of nocturnal hypoglycemia.

Mechanism of action

Insulin glargine binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism. Insulin glargine is completely soluble at pH 4, the pH of administered solution, and has low solubility at physiological pH 7.4. Upon subcuteous injection, the solution is neutralized resulting in the formation of microprecipitates. Small amounts of insulin glargine are released from microprecipitates giving the drug a relatively constant concentration over time profile over 24 hours with no pronounced peak. This release mechanism allows the drug to mimic basal insulin levels within the body.

TargetActionsOrganism
AInsulin receptor
agonist
Human
UInsulin-like growth factor 1 receptor
agonist
Human
Absorption

Because of the modifications to the A and B chain, the isoelectric point shifts towards a neutral pH and insulin glargine is more stable in acidic conditions than regular insulin. As insulin glargine is less soluble at neutral pH, once injected, forms microprecipitates. Slow release of insulin glargine from microprecipitates provides a relatively constant concentration of insulin over 24 hours. Onset of action is approximately 1.1 hours.

Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Partly metabolized to two active metabolites with similar in vitro activity to insulin: A21-Gly-insulin and A21-Gly-des-B30-Thr-insulin.

Route of elimination
Not Available
Half life

Not reported in humans; 30 hours in vitro in mammalian reticulocytes.

Clearance
Not Available
Toxicity

Inappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia. Other adverse events that may occur include allergic reaction, injection site reaction, lipodystrophy, pruritis, and rash.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
2,4-thiazolidinedione2,4-thiazolidinedione may increase the hypoglycemic activities of Insulin Glargine.Investigational
7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline may increase the hypoglycemic activities of Insulin Glargine.Experimental
AcarboseAcarbose may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Insulin Glargine.Investigational, Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Glargine.Approved, Vet Approved
AICA ribonucleotideAICA ribonucleotide may increase the hypoglycemic activities of Insulin Glargine.Experimental, Investigational
AlaproclateAlaproclate may increase the hypoglycemic activities of Insulin Glargine.Experimental
AllicinAllicin may increase the hypoglycemic activities of Insulin Glargine.Investigational
AlogliptinAlogliptin may increase the hypoglycemic activities of Insulin Glargine.Approved
AloxiprinAloxiprin may increase the hypoglycemic activities of Insulin Glargine.Experimental
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Insulin Glargine.Approved
AmphetamineAmphetamine may increase the hypoglycemic activities of Insulin Glargine.Approved, Illicit
AripiprazoleThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Atazanavir.Approved, Investigational
BalaglitazoneBalaglitazone may increase the hypoglycemic activities of Insulin Glargine.Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
Bempedoic acidBempedoic acid may increase the hypoglycemic activities of Insulin Glargine.Investigational
BendroflumethiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
BetamethasoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrexpiprazoleThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Brexpiprazole.Approved
BrofaromineBrofaromine may increase the hypoglycemic activities of Insulin Glargine.Experimental
BuforminBuformin may increase the hypoglycemic activities of Insulin Glargine.Investigational, Withdrawn
BumetanideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Buserelin.Approved
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Insulin Glargine.Approved
Carbaspirin calciumCarbaspirin calcium may increase the hypoglycemic activities of Insulin Glargine.Experimental, Investigational
CarbutamideCarbutamide may increase the hypoglycemic activities of Insulin Glargine.Experimental
CaroxazoneCaroxazone may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
CastanospermineCastanospermine may increase the hypoglycemic activities of Insulin Glargine.Experimental
CeritinibThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorpropamideInsulin Glargine may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Chlorthalidone.Approved
CiglitazoneCiglitazone may increase the hypoglycemic activities of Insulin Glargine.Experimental
CinoxacinCinoxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational, Withdrawn
CitalopramCitalopram may increase the hypoglycemic activities of Insulin Glargine.Approved
ClozapineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Cortisone acetate.Approved
CyclopenthiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Cyclopenthiazide.Experimental
Cyproterone acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Insulin Glargine.Investigational
DarunavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Darunavir.Approved
DeoxyspergualinDeoxyspergualin may increase the hypoglycemic activities of Insulin Glargine.Investigational
dersalazinedersalazine may increase the hypoglycemic activities of Insulin Glargine.Investigational
DesogestrelThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Insulin Glargine.Approved
DexamethasoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DiazoxideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Diazoxide.Approved
DienogestThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Insulin Glargine.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Insulin Glargine.Illicit
DisopyramideInsulin Glargine may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Drospirenone.Approved
DulaglutideDulaglutide may increase the hypoglycemic activities of Insulin Glargine.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Insulin Glargine.Approved
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Insulin Glargine.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
EpinephrineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
EstradiolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ethinyl Estradiol.Approved
Ethynodiol diacetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
EverolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Everolimus.Approved
ExenatideExenatide may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
FleroxacinFleroxacin may increase the hypoglycemic activities of Insulin Glargine.Approved
FludrocortisoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Insulin Glargine.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Insulin Glargine.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational, Vet Approved
FurosemideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Furosemide.Approved, Vet Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Insulin Glargine.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
GlibornurideGlibornuride may increase the hypoglycemic activities of Insulin Glargine.Investigational, Withdrawn
GliclazideInsulin Glargine may increase the hypoglycemic activities of Gliclazide.Approved
GlimepirideInsulin Glargine may increase the hypoglycemic activities of Glimepiride.Approved
GlipizideInsulin Glargine may increase the hypoglycemic activities of Glipizide.Approved
GliquidoneGliquidone may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
GLPG-0492GLPG-0492 may increase the hypoglycemic activities of Insulin Glargine.Investigational
GlyburideInsulin Glargine may increase the hypoglycemic activities of Glyburide.Approved
GoserelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Insulin Glargine.Investigational, Withdrawn
GuacetisalGuacetisal may increase the hypoglycemic activities of Insulin Glargine.Experimental
GusperimusGusperimus may increase the hypoglycemic activities of Insulin Glargine.Investigational
HarmalineHarmaline may increase the hypoglycemic activities of Insulin Glargine.Experimental
Hemoglobin crosfumarilHemoglobin crosfumaril may increase the hypoglycemic activities of Insulin Glargine.Experimental
HistrelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Histrelin.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Insulin Glargine.Experimental
HydrochlorothiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydroflumethiazide.Approved, Investigational
Hydroxyprogesterone caproateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
IloperidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Insulin Glargine.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Indinavir.Approved
Insulin AspartInsulin Glargine may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirInsulin Glargine may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlulisineInsulin Glargine may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanInsulin Human may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
Insulin LisproInsulin Lispro may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Insulin Glargine.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Insulin Glargine.Approved
LanreotideInsulin Glargine may increase the hypoglycemic activities of Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Insulin Glargine.Approved
LevonorgestrelThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LinagliptinLinagliptin may increase the hypoglycemic activities of Insulin Glargine.Approved
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Insulin Glargine.Approved, Nutraceutical
LiraglutideLiraglutide may increase the hypoglycemic activities of Insulin Glargine.Approved
LopinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
MecaserminInsulin Glargine may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Insulin Glargine.Approved
MesteroloneMesterolone may increase the hypoglycemic activities of Insulin Glargine.Experimental
MestranolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Mestranol.Approved
MetforminMetformin may increase the hypoglycemic activities of Insulin Glargine.Approved
MethotrimeprazineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Methyclothiazide.Approved
Methyl salicylateMethyl salicylate may increase the hypoglycemic activities of Insulin Glargine.Approved, Vet Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
MethylprednisoloneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Insulin Glargine.Approved
MetolazoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Metolazone.Approved
MifepristoneInsulin Glargine may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MiglitolMiglitol may increase the hypoglycemic activities of Insulin Glargine.Approved
MiglustatMiglustat may increase the hypoglycemic activities of Insulin Glargine.Approved
MilnacipranMilnacipran may increase the hypoglycemic activities of Insulin Glargine.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Insulin Glargine.Approved
MitiglinideMitiglinide may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
MoclobemideMoclobemide may increase the hypoglycemic activities of Insulin Glargine.Approved
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
NandroloneNandrolone may increase the hypoglycemic activities of Insulin Glargine.Experimental, Investigational
Nandrolone decanoateNandrolone decanoate may increase the hypoglycemic activities of Insulin Glargine.Approved, Illicit
NateglinideInsulin Glargine may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Insulin Glargine.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Insulin Glargine.Investigational
NiacinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
NilotinibThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Insulin Glargine.Investigational
NorethisteroneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Insulin Glargine.Approved
NorgestimateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
OctreotideInsulin Glargine may increase the hypoglycemic activities of Octreotide.Approved, Investigational
OlanzapineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Insulin Glargine.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
Oxolinic acidOxolinic acid may increase the hypoglycemic activities of Insulin Glargine.Experimental
OxymetholoneOxymetholone may increase the hypoglycemic activities of Insulin Glargine.Approved, Illicit
PaliperidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Paliperidone.Approved
PargylinePargyline may increase the hypoglycemic activities of Insulin Glargine.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
PasireotideInsulin Glargine may increase the hypoglycemic activities of Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Insulin Glargine.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Insulin Glargine.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Insulin Glargine.Approved
PentamidineInsulin Glargine may increase the hypoglycemic activities of Pentamidine.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Insulin Glargine.Approved
PhenforminPhenformin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational, Withdrawn
PheniprazinePheniprazine may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
PioglitazonePioglitazone may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
Pipemidic acidPipemidic acid may increase the hypoglycemic activities of Insulin Glargine.Experimental
PiperazineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Pipotiazine.Approved, Investigational
PirlindolePirlindole may increase the hypoglycemic activities of Insulin Glargine.Approved
Piromidic acidPiromidic acid may increase the hypoglycemic activities of Insulin Glargine.Experimental
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
PolythiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Polythiazide.Approved
PramlintidePramlintide may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
PrednisoloneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProcarbazineProcarbazine may increase the hypoglycemic activities of Insulin Glargine.Approved
ProgesteroneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Progesterone.Approved, Vet Approved
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Insulin Glargine.Investigational
QuetiapineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Quinethazone.Approved
QuinineInsulin Glargine may increase the hypoglycemic activities of Quinine.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Insulin Glargine.Approved
RepaglinideInsulin Glargine may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RisperidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ritonavir.Approved, Investigational
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
RufloxacinRufloxacin may increase the hypoglycemic activities of Insulin Glargine.Experimental
SafrazineSafrazine may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Insulin Glargine.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Saquinavir.Approved, Investigational
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Insulin Glargine.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Insulin Glargine.Approved
SirolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Sirolimus.Approved, Investigational
SitafloxacinSitafloxacin may increase the hypoglycemic activities of Insulin Glargine.Experimental, Investigational
SitagliptinSitagliptin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
SotagliflozinSotagliflozin may increase the hypoglycemic activities of Insulin Glargine.Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
StanozololStanozolol may increase the hypoglycemic activities of Insulin Glargine.Approved, Vet Approved
SulfadiazineInsulin Glargine may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazoleInsulin Glargine may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazoleInsulin Glargine may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SulodexideSulodexide may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
SunitinibInsulin Glargine may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
TemsirolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
Testosterone PropionateTestosterone Propionate may increase the hypoglycemic activities of Insulin Glargine.Approved, Vet Approved
TipranavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamideInsulin Glargine may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamideInsulin Glargine may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Insulin Glargine.Approved
TorasemideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Insulin Glargine.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Insulin Glargine.Approved
TriamcinoloneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TriptorelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TroglitazoneTroglitazone may increase the hypoglycemic activities of Insulin Glargine.Investigational, Withdrawn
Trolamine salicylateTrolamine salicylate may increase the hypoglycemic activities of Insulin Glargine.Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Insulin Glargine.Approved
VildagliptinVildagliptin may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
VogliboseVoglibose may increase the hypoglycemic activities of Insulin Glargine.Approved, Investigational
VorinostatThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Insulin Glargine.Withdrawn
ZiprasidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ziprasidone.Approved
Food Interactions
Not Available

References

General References
  1. Chatterjee S, Tringham JR, Davies MJ: Insulin glargine and its place in the treatment of Types 1 and 2 diabetes mellitus. Expert Opin Pharmacother. 2006 Jul;7(10):1357-71. [PubMed:16805721]
  2. Dunn CJ, Plosker GL, Keating GM, McKeage K, Scott LJ: Insulin glargine: an updated review of its use in the management of diabetes mellitus. Drugs. 2003;63(16):1743-78. [PubMed:12904090]
  3. Home PD, Ashwell SG: An overview of insulin glargine. Diabetes Metab Res Rev. 2002 Sep-Oct;18 Suppl 3:S57-63. [PubMed:12324987]
  4. Jones R: Insulin glargine (Aventis Pharma). IDrugs. 2000 Sep;3(9):1081-7. [PubMed:16049868]
  5. Wang F, Carabino JM, Vergara CM: Insulin glargine: a systematic review of a long-acting insulin analogue. Clin Ther. 2003 Jun;25(6):1541-77, discussion 1539-40. [PubMed:12860485]
  6. Warren E, Weatherley-Jones E, Chilcott J, Beverley C: Systematic review and economic evaluation of a long-acting insulin analogue, insulin glargine. Health Technol Assess. 2004 Nov;8(45):iii, 1-57. [PubMed:15525480]
  7. Owens DR, Bolli GB: Beyond the era of NPH insulin--long-acting insulin analogs: chemistry, comparative pharmacology, and clinical application. Diabetes Technol Ther. 2008 Oct;10(5):333-49. doi: 10.1089/dia.2008.0023. [PubMed:18715209]
External Links
KEGG Drug
D03250
PubChem Substance
46507981
ChEMBL
CHEMBL1201497
Therapeutic Targets Database
DAP001088
PharmGKB
PA449992
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Insulin_glargine
ATC Codes
A10AE04 — Insulin glargine
AHFS Codes
  • 68:20.08 — Insulins
FDA label
Download (51.2 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0RecruitingPreventionRetinopathy, Diabetic1
1Active Not RecruitingBasic ScienceHealthy Volunteers1
1CompletedNot AvailableDiabetes Mellitus (DM)1
1CompletedNot AvailableDiabetes, Diabetes Mellitus Type 12
1CompletedBasic ScienceDiabetes, Diabetes Mellitus Type 14
1CompletedBasic ScienceHealthy Volunteers1
1CompletedBasic ScienceType 2 Diabetes Mellitus2
1CompletedTreatmentDelivery Systems / Diabetes / Type 2 Diabetes Mellitus1
1CompletedTreatmentDiabetes1
1CompletedTreatmentDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus (DM) / Hyperglycemias1
1CompletedTreatmentDiabetes, Diabetes Mellitus Type 15
1CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 19
1CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 1 / Healthy Volunteers2
1CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus1
1CompletedTreatmentDiabetes / Healthy Volunteers2
1CompletedTreatmentDiabetes / Healthy Volunteers / Type 2 Diabetes Mellitus2
1CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus3
1CompletedTreatmentType 2 Diabetes Mellitus5
2CompletedNot AvailableDiabetes, Diabetes Mellitus Type 11
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 13
2CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 11
2CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus3
2CompletedTreatmentNonalcoholic Fatty Liver Disease / Nonalcoholic Steatohepatitis / Type 2 Diabetes Mellitus1
2CompletedTreatmentType 2 Diabetes Mellitus6
2TerminatedTreatmentType 2 Diabetes Mellitus1
2, 3CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
3Active Not RecruitingTreatmentComparative Effectiveness of Glycemia-lowering Medications / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
3Active Not RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus3
3Active Not RecruitingTreatmentType 2 Diabetes Mellitus2
3CompletedPreventionAtherosclerosis / Cardiovascular Disease (CVD) / Coronary Heart Disease (CHD) / Diabetes Mellitus (DM) / Hypercholesterolaemia / Hypertensive / Type 2 Diabetes Mellitus1
3CompletedTreatmentCardiovascular Disease (CVD) / Hyperglycemias / Myocardial Infarction (MI)1
3CompletedTreatmentChronic Kidney Disease (CKD) / Type 2 Diabetes Mellitus1
3CompletedTreatmentDawn Phenomenon / Diabetes, Diabetes Mellitus Type 11
3CompletedTreatmentDiabetes Mellitus (DM)4
3CompletedTreatmentDiabetes Mellitus, Insulin-Dependent1
3CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent1
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 112
3CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 16
3CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus26
3CompletedTreatmentHypercholesterolaemia1
3CompletedTreatmentPoor Glycemic Control1
3CompletedTreatmentType 2 Diabetes Mellitus57
3Not Yet RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
3Not Yet RecruitingTreatmentType 2 Diabetes Mellitus1
3RecruitingTreatmentDiabetes, Diabetes Mellitus Type 13
3RecruitingTreatmentHyperglycemias / Stroke, Acute1
3RecruitingTreatmentType 1 Diabetes Mellitus-Type 2 Diabetes Mellitus1
3RecruitingTreatmentType 2 Diabetes Mellitus10
3TerminatedTreatmentAMI1
3TerminatedTreatmentDiabetes, Diabetes Mellitus Type 11
3TerminatedTreatmentHyperglycemias1
3TerminatedTreatmentLeukemias / Malignant Lymphomas1
3TerminatedTreatmentType 2 Diabetes Mellitus2
3Unknown StatusTreatmentCystic Fibrosis (CF) / Glucose tolerance impaired1
3Unknown StatusTreatmentType I Diabetes1
3WithdrawnSupportive CareHyperglycemias / Leukemias1
3WithdrawnTreatmentType 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentDiabetes, Diabetes Mellitus Type 1 / Nocturnal Hypoglycemia / Recurrent Severe Hypoglycaemia1
4Active Not RecruitingTreatmentType 2 Diabetes Mellitus4
4CompletedNot AvailableType 2 Diabetes Mellitus1
4CompletedBasic ScienceType 2 Diabetes Mellitus1
4CompletedPreventionCoronary Artery Disease1
4CompletedTreatmentAcute Myocardial Infarction (AMI) / Type 2 Diabetes Mellitus1
4CompletedTreatmentCardiovascular Disease (CVD) / Endothelial Dysfunction / Type 2 Diabetes Mellitus1
4CompletedTreatmentCongestive Heart Failure (CHF) / Type 2 Diabetes Mellitus1
4CompletedTreatmentDiabetes4
4CompletedTreatmentDiabetes Mellitus (DM)8
4CompletedTreatmentDiabetes, Diabetes Mellitus Type 110
4CompletedTreatmentDiabetes / Diabetes, Diabetes Mellitus Type 11
4CompletedTreatmentDiabetes / General Surgery1
4CompletedTreatmentDiabetes / Hyperglycemias2
4CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus6
4CompletedTreatmentHospitalization / Hyperglycemias / Type 2 Diabetes Mellitus1
4CompletedTreatmentHyperglycemias1
4CompletedTreatmentHyperglycemias / Type 2 Diabetes Mellitus1
4CompletedTreatmentHypoglycemia / Type 2 Diabetes Mellitus1
4CompletedTreatmentImpaired Renal Function / Type 2 Diabetes Mellitus1
4CompletedTreatmentInpatient Hyperglycemia / Type 2 Diabetes Mellitus1
4CompletedTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD)1
4CompletedTreatmentSecondary Drug Failure / Type 2 Diabetes Mellitus1
4CompletedTreatmentType 2 Diabetes Mellitus66
4Not Yet RecruitingTreatmentType 2 Diabetes Mellitus1
4Not Yet RecruitingTreatmentType2 Diabetes1
4RecruitingHealth Services ResearchType 2 Diabetes Mellitus1
4RecruitingPreventionHyperglycemias2
4RecruitingScreeningDiabetes Mellitus (DM)1
4RecruitingTreatmentDiabetes, Diabetes Mellitus Type 13
4RecruitingTreatmentDiabetes, Diabetes Mellitus Type 1 / Ketoacidosis, Diabetic1
4RecruitingTreatmentNon-Alcoholic Fatty Liver Disease (NAFLD) / Type 2 Diabetes Mellitus1
4RecruitingTreatmentType 2 Diabetes Mellitus6
4RecruitingTreatmentType 2 Diabetes Patients1
4TerminatedTreatmentDiabetes Mellitus (DM)1
4TerminatedTreatmentPost-Transplant Glucocorticoid Induced Diabetes1
4TerminatedTreatmentType 2 Diabetes Mellitus7
4Unknown StatusPreventionType 2 Diabetes Mellitus1
4Unknown StatusTreatmentCoronary Artery Disease / Type 2 Diabetes Mellitus1
4Unknown StatusTreatmentDiabetes1
4Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 12
4Unknown StatusTreatmentInsulin-requiring Type 2 Diabetes Mellitus1
4Unknown StatusTreatmentLiver Cirrhosis / Type 2 Diabetes Mellitus1
4Unknown StatusTreatmentType 2 Diabetes Mellitus1
4WithdrawnTreatmentType 2 Diabetes Mellitus1
Not AvailableActive Not RecruitingNot AvailableDiabetes1
Not AvailableCompletedNot AvailableBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedNot AvailableDiabetes1
Not AvailableCompletedNot AvailableDiabetes Mellitus (DM)1
Not AvailableCompletedBasic ScienceDiabetes1
Not AvailableCompletedTreatmentBMI >30 kg/m2 / Type 2 Diabetes Mellitus1
Not AvailableCompletedTreatmentDiabetes2
Not AvailableCompletedTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedTreatmentDiabetes / Hyperglycemias1
Not AvailableCompletedTreatmentDiabetic Peripheral Neuropathy (DPN) / Type 2 Diabetes Mellitus1
Not AvailableCompletedTreatmentKetoacidosis, Diabetic1
Not AvailableCompletedTreatmentType 2 Diabetes Mellitus6
Not AvailableNot Yet RecruitingTreatmentType 2 Diabetes Mellitus1
Not AvailableRecruitingTreatmentDiabetes, Diabetes Mellitus Type 1 / Ketoacidosis, Diabetic1
Not AvailableRecruitingTreatmentType 2 Diabetes Mellitus1
Not AvailableTerminatedTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableUnknown StatusPreventionPre-Diabetic1
Not AvailableUnknown StatusTreatmentDiabetes Mellitus (DM)1
Not AvailableUnknown StatusTreatmentDiabetes, Diabetes Mellitus Type 1 / Hypoglycemia1
Not AvailableWithdrawnTreatmentType 2 Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
  • Sanofi aventis us llc
Packagers
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous100 Units/ml
Injection, solutionSubcutaneous100 [iU]/mL
SolutionSubcutaneous100 unit
Injection, solutionSubcutaneous
Injection, solutionSubcutaneous300 U/mL
Injection, solutionSubcutaneous300 units/ml
SolutionSubcutaneous300 unit
Prices
Unit descriptionCostUnit
Lantus SoloStar 100 unit/ml Solution 1 Box = Five 3ml Syringes223.89USD box
Lantus 100 unit/ml Solution 10ml Vial111.88USD vial
Lantus for OptiClik 100 unit/ml Solution 3ml Cartridge44.78USD cartridge
Lantus 100 unit/ml cartridge14.35USD ml
Lantus solostar 100 unit/ml14.35USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US6100376No1992-11-062009-11-06Us
CA1339044No1997-04-012014-04-01Canada
US9011391No2004-03-262024-03-26Us
US9233211No2004-03-022024-03-02Us
US8603044No2004-03-022024-03-02Us
US8512297No2004-09-152024-09-15Us
US8679069No2005-04-122025-04-12Us
US8992486No2004-06-052024-06-05Us
US8556864No2004-03-032024-03-03Us
US7918833Yes2008-03-232028-03-23Us
US7713930Yes2003-12-132023-12-13Us
US7476652Yes2004-01-232024-01-23Us
US9561331No2004-08-282024-08-28Us
US9623189No2004-08-192024-08-19Us
US9610409No2004-03-022024-03-02Us
US9526844No2004-03-022024-03-02Us
US9604008No2004-03-022024-03-02Us
US9533105No2004-08-172024-08-17Us
US9408979No2004-03-022024-03-02Us
US9604009No2004-08-162024-08-16Us
USRE45313No2000-07-122020-07-12Us
US9526764No2009-10-092029-10-09Us
US9345750No2011-05-182031-05-18Us
US9707176No2010-11-112030-11-11Us
US9775954No2004-03-022024-03-02Us

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)81 °CKhachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001)
hydrophobicity0.098Not Available
isoelectric point6.88Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Receptor signaling protein tyrosine kinase activity
Specific Function
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (...
Gene Name
INSR
Uniprot ID
P06213
Uniprot Name
Insulin receptor
Molecular Weight
156331.465 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Le Roith D: Insulin glargine and receptor-mediated signalling: clinical implications in treating type 2 diabetes. Diabetes Metab Res Rev. 2007 Nov;23(8):593-9. [PubMed:17922476]
  3. Sciacca L, Cassarino MF, Genua M, Pandini G, Le Moli R, Squatrito S, Vigneri R: Insulin analogues differently activate insulin receptor isoforms and post-receptor signalling. Diabetologia. 2010 Aug;53(8):1743-53. doi: 10.1007/s00125-010-1760-6. Epub 2010 Apr 28. [PubMed:20424816]
  4. Wada T, Azegami M, Sugiyama M, Tsuneki H, Sasaoka T: Characteristics of signalling properties mediated by long-acting insulin analogue glargine and detemir in target cells of insulin. Diabetes Res Clin Pract. 2008 Sep;81(3):269-77. doi: 10.1016/j.diabres.2008.05.007. Epub 2008 Jun 27. [PubMed:18585815]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Agonist
General Function
Protein tyrosine kinase activity
Specific Function
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involv...
Gene Name
IGF1R
Uniprot ID
P08069
Uniprot Name
Insulin-like growth factor 1 receptor
Molecular Weight
154791.73 Da
References
  1. Smith TJ: Insulin-like growth factor-I regulation of immune function: a potential therapeutic target in autoimmune diseases? Pharmacol Rev. 2010 Jun;62(2):199-236. doi: 10.1124/pr.109.002469. Epub 2010 Apr 14. [PubMed:20392809]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inducer
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
Gene Name
CYP1A2
Uniprot ID
P05177
Uniprot Name
Cytochrome P450 1A2
Molecular Weight
58293.76 Da
References
  1. Drug Interactions: Cytochrome P450 Drug Interaction Table [Link]

Drug created on June 13, 2005 07:24 / Updated on November 19, 2017 20:34