You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameTrastuzumab
Accession NumberDB00072  (BTD00098, BIOD00098)
TypeBiotech
GroupsApproved, Investigational
DescriptionA recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture.
Protein structureDb00072
Related Articles
Protein chemical formulaC6470H10012N1726O2013S42
Protein average weight145531.5 Da
Sequences
>Anti-HER2 Light chain (1 and 2)
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Anti-HER2 Heavy chain (1 and 2)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
Anti HER2
Ig gamma-1 chain C region
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HerceptinPowder, for solution440 mgIntravenousHoffmann La Roche Limited1999-08-23Not applicableCanada
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Limited2000-08-28Not applicableEu
HerceptinKitGenentech, Inc.1998-09-25Not applicableUs
HerceptinInjection, powder, for solution150 mgIntravenousRoche Registration Limited2000-08-28Not applicableEu
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Limited2000-08-28Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
HerclonRoche
Brand mixtures
NameLabellerIngredients
Perjeta-herceptinHoffmann La Roche Limited
SaltsNot Available
Categories
UNIIP188ANX8CK
CAS number180288-69-1
Pharmacology
IndicationFor treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2.
Structured Indications
PharmacodynamicsUsed in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death.
Mechanism of actionTrastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells.
TargetKindPharmacological actionActionsOrganismUniProt ID
Receptor tyrosine-protein kinase erbB-2Proteinyes
antibody
HumanP04626 details
Epidermal growth factor receptorProteinunknownNot AvailableHumanP00533 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Complement C1s subcomponentProteinunknownNot AvailableHumanP09871 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
Related Articles
AbsorptionPeak and trough plasma concentrations at steady state (between weeks 16 and 32) approximately 123 and 79 mcg/mL, respectively.
Volume of distribution
  • 44 mL/kg
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of eliminationNot Available
Half lifeaverage 28.5 days. Pharmacokinetics are nonlinear; increased doses are associated with increased mean half-life and decreased clearance.
Clearance

Elimination may involve clearance of IgG through the reticuloendothelial system.

ToxicityAdministration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy.
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Trastuzumab Action PathwayDrug actionSMP00476
SNP Mediated Effects
Interacting Gene/EnzymeSNP RS IDAllele nameDefining changeEffectReference(s)
Fibroblast growth factor receptor 4
Gene symbol: FGFR4
UniProt: P22455
rs351855 Not AvailableC AlleleReduced response to herceptin16822847
SNP Mediated Adverse Drug Reactions
Interacting Gene/EnzymeSNP RS IDAllele nameDefining changeAdverse ReactionReference(s)
Receptor tyrosine-protein kinase erbB-2
Gene symbol: ERBB2
UniProt: P04626
rs1801200 Not AvailableG Allele, heterozygoteCardiotoxicity17693647
Interactions
Drug Interactions
DrugInteractionDrug group
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideTrastuzumab may increase the cardiotoxic activities of 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.Experimental
2-MethoxyestradiolTrastuzumab may increase the cardiotoxic activities of 2-Methoxyestradiol.Investigational
2-MethoxyethanolTrastuzumab may increase the neutropenic activities of 2-Methoxyethanol.Experimental
3-MethoxybenzamideTrastuzumab may increase the cardiotoxic activities of 3-Methoxybenzamide.Experimental
3,4-Dihydroxybenzoic AcidTrastuzumab may increase the cardiotoxic activities of 3,4-Dihydroxybenzoic Acid.Experimental
5,10-Dideazatetrahydrofolic AcidTrastuzumab may increase the cardiotoxic activities of 5,10-Dideazatetrahydrofolic Acid.Experimental
7-HydroxystaurosporineTrastuzumab may increase the cardiotoxic activities of 7-Hydroxystaurosporine.Experimental
8-azaguanineTrastuzumab may increase the cardiotoxic activities of 8-azaguanine.Experimental
9-(2-phosphonylmethoxyethyl)-2,6-diaminopurineTrastuzumab may increase the cardiotoxic activities of 9-(2-phosphonylmethoxyethyl)-2,6-diaminopurine.Investigational
AbataceptTrastuzumab may increase the neutropenic activities of Abatacept.Approved
abetimusTrastuzumab may increase the neutropenic activities of abetimus.Investigational
AbirateroneTrastuzumab may increase the cardiotoxic activities of Abiraterone.Approved
ABR-215757Trastuzumab may increase the neutropenic activities of ABR-215757.Investigational
ABT-263Trastuzumab may increase the cardiotoxic activities of ABT-263.Investigational
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Trastuzumab.Approved
AclarubicinTrastuzumab may increase the cardiotoxic activities of Aclarubicin.Investigational
ActeosideTrastuzumab may increase the cardiotoxic activities of Acteoside.Investigational
AdalimumabTrastuzumab may increase the neutropenic activities of Adalimumab.Approved
Adefovir DipivoxilTrastuzumab may increase the neutropenic activities of Adefovir Dipivoxil.Approved, Investigational
AfatinibTrastuzumab may increase the cardiotoxic activities of Afatinib.Approved
AfelimomabTrastuzumab may increase the neutropenic activities of Afelimomab.Investigational
AfimoxifeneTrastuzumab may increase the cardiotoxic activities of Afimoxifene.Investigational
AfliberceptTrastuzumab may increase the cardiotoxic activities of Aflibercept.Approved
AlatrofloxacinTrastuzumab may increase the cardiotoxic activities of Alatrofloxacin.Withdrawn
AlbendazoleTrastuzumab may increase the cardiotoxic activities of Albendazole.Approved, Vet Approved
AldesleukinTrastuzumab may increase the cardiotoxic activities of Aldesleukin.Approved
AlefaceptTrastuzumab may increase the neutropenic activities of Alefacept.Approved, Withdrawn
AlemtuzumabTrastuzumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
alicaforsenTrastuzumab may increase the neutropenic activities of alicaforsen.Investigational
AlitretinoinTrastuzumab may increase the cardiotoxic activities of Alitretinoin.Approved, Investigational
Alpha-DifluoromethylornithineTrastuzumab may increase the cardiotoxic activities of Alpha-Difluoromethylornithine.Experimental
ALT-110The therapeutic efficacy of ALT-110 can be decreased when used in combination with Trastuzumab.Investigational
AltretamineTrastuzumab may increase the cardiotoxic activities of Altretamine.Approved
Amg 386Trastuzumab may increase the cardiotoxic activities of Amg 386.Investigational
Amg 827Trastuzumab may increase the neutropenic activities of Amg 827.Investigational
AminocamptothecinTrastuzumab may increase the cardiotoxic activities of Aminocamptothecin.Investigational
AminoglutethimideTrastuzumab may increase the cardiotoxic activities of Aminoglutethimide.Approved
Aminolevulinic acidTrastuzumab may increase the cardiotoxic activities of Aminolevulinic acid.Approved
AmonafideTrastuzumab may increase the cardiotoxic activities of Amonafide.Investigational
AmrubicinTrastuzumab may increase the cardiotoxic activities of Amrubicin.Approved, Investigational
AmsacrineTrastuzumab may increase the cardiotoxic activities of Amsacrine.Approved
AnagrelideTrastuzumab may increase the cardiotoxic activities of Anagrelide.Approved
AnakinraTrastuzumab may increase the neutropenic activities of Anakinra.Approved
AnastrozoleTrastuzumab may increase the cardiotoxic activities of Anastrozole.Approved, Investigational
AnecortaveTrastuzumab may increase the cardiotoxic activities of Anecortave.Investigational
annamycinTrastuzumab may increase the cardiotoxic activities of annamycin.Investigational
Anti-thymocyte Globulin (Rabbit)Trastuzumab may increase the neutropenic activities of Anti-thymocyte Globulin (Rabbit).Approved
AnvirzelAnvirzel may decrease the cardiotoxic activities of Trastuzumab.Investigational
AP 12009Trastuzumab may increase the cardiotoxic activities of AP 12009.Investigational
AP24534Trastuzumab may increase the cardiotoxic activities of AP24534.Investigational
ApaziquoneTrastuzumab may increase the cardiotoxic activities of Apaziquone.Investigational
ApremilastTrastuzumab may increase the neutropenic activities of Apremilast.Approved, Investigational
Arsenic trioxideTrastuzumab may increase the cardiotoxic activities of Arsenic trioxide.Approved, Investigational
ASA404Trastuzumab may increase the cardiotoxic activities of ASA404.Investigational
AsparaginaseTrastuzumab may increase the cardiotoxic activities of Asparaginase.Approved
AT-101Trastuzumab may increase the cardiotoxic activities of AT-101.Investigational
AxitinibTrastuzumab may increase the cardiotoxic activities of Axitinib.Approved, Investigational
AzacitidineTrastuzumab may increase the cardiotoxic activities of Azacitidine.Approved, Investigational
AzathioprineTrastuzumab may increase the cardiotoxic activities of Azathioprine.Approved
AZD2171Trastuzumab may increase the cardiotoxic activities of AZD2171.Investigational
Azd4547Trastuzumab may increase the cardiotoxic activities of Azd4547.Investigational
Azelaic AcidTrastuzumab may increase the cardiotoxic activities of Azelaic Acid.Approved
BasiliximabTrastuzumab may increase the neutropenic activities of Basiliximab.Approved, Investigational
BatimastatTrastuzumab may increase the cardiotoxic activities of Batimastat.Experimental
BelataceptTrastuzumab may increase the neutropenic activities of Belatacept.Approved
BelimumabThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Belimumab.Approved
BelinostatTrastuzumab may increase the cardiotoxic activities of Belinostat.Approved, Investigational
BelotecanTrastuzumab may increase the cardiotoxic activities of Belotecan.Investigational
BendamustineTrastuzumab may increase the cardiotoxic activities of Bendamustine.Approved, Investigational
BenznidazoleTrastuzumab may increase the neutropenic activities of Benznidazole.Investigational
BesifloxacinTrastuzumab may increase the cardiotoxic activities of Besifloxacin.Approved
BetamethasoneTrastuzumab may increase the neutropenic activities of Betamethasone.Approved, Vet Approved
Betulinic AcidTrastuzumab may increase the cardiotoxic activities of Betulinic Acid.Investigational
BevacizumabTrastuzumab may increase the cardiotoxic activities of Bevacizumab.Approved, Investigational
BexaroteneTrastuzumab may increase the cardiotoxic activities of Bexarotene.Approved, Investigational
Bgj398Trastuzumab may increase the cardiotoxic activities of Bgj398.Investigational
BicalutamideTrastuzumab may increase the cardiotoxic activities of Bicalutamide.Approved
BizelesinTrastuzumab may increase the cardiotoxic activities of Bizelesin.Investigational
BleomycinTrastuzumab may increase the cardiotoxic activities of Bleomycin.Approved
BlinatumomabTrastuzumab may increase the cardiotoxic activities of Blinatumomab.Approved
Bmn 673Trastuzumab may increase the cardiotoxic activities of Bmn 673.Investigational
BortezomibTrastuzumab may increase the cardiotoxic activities of Bortezomib.Approved, Investigational
BosutinibTrastuzumab may increase the cardiotoxic activities of Bosutinib.Approved
Brentuximab vedotinTrastuzumab may increase the cardiotoxic activities of Brentuximab vedotin.Approved
BriakinumabTrastuzumab may increase the neutropenic activities of Briakinumab.Investigational
BroxuridineTrastuzumab may increase the cardiotoxic activities of Broxuridine.Investigational
Bryostatin 1Trastuzumab may increase the cardiotoxic activities of Bryostatin 1.Investigational
BSI-201Trastuzumab may increase the cardiotoxic activities of BSI-201.Investigational
BudesonideTrastuzumab may increase the neutropenic activities of Budesonide.Approved
BusulfanTrastuzumab may increase the cardiotoxic activities of Busulfan.Approved, Investigational
Buthionine SulfoximineTrastuzumab may increase the cardiotoxic activities of Buthionine Sulfoximine.Investigational
C1 Esterase Inhibitor (Human)Trastuzumab may increase the neutropenic activities of C1 Esterase Inhibitor (Human).Approved
CabazitaxelTrastuzumab may increase the cardiotoxic activities of Cabazitaxel.Approved
CabergolineTrastuzumab may increase the cardiotoxic activities of Cabergoline.Approved
CabozantinibTrastuzumab may increase the cardiotoxic activities of Cabozantinib.Approved
CaiTrastuzumab may increase the cardiotoxic activities of Cai.Investigational
CalcipotriolTrastuzumab may increase the cardiotoxic activities of Calcipotriol.Approved
CamptothecinTrastuzumab may increase the cardiotoxic activities of Camptothecin.Experimental
CanakinumabTrastuzumab may increase the neutropenic activities of Canakinumab.Approved, Investigational
CapecitabineTrastuzumab may increase the cardiotoxic activities of Capecitabine.Approved, Investigational
CarboplatinTrastuzumab may increase the cardiotoxic activities of Carboplatin.Approved
CarfilzomibTrastuzumab may increase the cardiotoxic activities of Carfilzomib.Approved
CarmofurTrastuzumab may increase the cardiotoxic activities of Carmofur.Withdrawn
CarmustineTrastuzumab may increase the cardiotoxic activities of Carmustine.Approved
CastanospermineTrastuzumab may increase the neutropenic activities of Castanospermine.Experimental
CatumaxomabTrastuzumab may increase the cardiotoxic activities of Catumaxomab.Investigational
CB1954Trastuzumab may increase the cardiotoxic activities of CB1954.Experimental
CDX-110The therapeutic efficacy of CDX-110 can be decreased when used in combination with Trastuzumab.Investigational
CediranibTrastuzumab may increase the cardiotoxic activities of Cediranib.Investigational
CelecoxibTrastuzumab may increase the cardiotoxic activities of Celecoxib.Approved, Investigational
CeritinibTrastuzumab may increase the cardiotoxic activities of Ceritinib.Approved
Certolizumab pegolTrastuzumab may increase the neutropenic activities of Certolizumab pegol.Approved
CetuximabTrastuzumab may increase the cardiotoxic activities of Cetuximab.Approved
ChlorambucilTrastuzumab may increase the cardiotoxic activities of Chlorambucil.Approved
ChlorotrianiseneTrastuzumab may increase the cardiotoxic activities of Chlorotrianisene.Withdrawn
CinoxacinTrastuzumab may increase the cardiotoxic activities of Cinoxacin.Approved, Withdrawn
CiprofloxacinTrastuzumab may increase the cardiotoxic activities of Ciprofloxacin.Approved, Investigational
CisplatinTrastuzumab may increase the cardiotoxic activities of Cisplatin.Approved
CladribineTrastuzumab may increase the cardiotoxic activities of Cladribine.Approved, Investigational
ClofarabineTrastuzumab may increase the cardiotoxic activities of Clofarabine.Approved, Investigational
clorarabineTrastuzumab may increase the cardiotoxic activities of clorarabine.Investigational
ColchicineTrastuzumab may increase the cardiotoxic activities of Colchicine.Approved
CordycepinTrastuzumab may increase the cardiotoxic activities of Cordycepin.Investigational
CorticotropinTrastuzumab may increase the neutropenic activities of Corticotropin.Approved, Vet Approved
Cortisone acetateTrastuzumab may increase the neutropenic activities of Cortisone acetate.Approved
CrenolanibTrastuzumab may increase the cardiotoxic activities of Crenolanib.Investigational
CrizotinibTrastuzumab may increase the cardiotoxic activities of Crizotinib.Approved
CurcuminTrastuzumab may increase the cardiotoxic activities of Curcumin.Investigational
CyclophosphamideTrastuzumab may increase the cardiotoxic activities of Cyclophosphamide.Approved, Investigational
CyclosporineTrastuzumab may increase the neutropenic activities of Cyclosporine.Approved, Investigational, Vet Approved
Cyproterone acetateTrastuzumab may increase the cardiotoxic activities of Cyproterone acetate.Approved, Investigational
CytarabineTrastuzumab may increase the cardiotoxic activities of Cytarabine.Approved, Investigational
DabrafenibTrastuzumab may increase the cardiotoxic activities of Dabrafenib.Approved
DacarbazineTrastuzumab may increase the cardiotoxic activities of Dacarbazine.Approved, Investigational
DaclizumabTrastuzumab may increase the neutropenic activities of Daclizumab.Approved, Investigational
DactinomycinTrastuzumab may increase the cardiotoxic activities of Dactinomycin.Approved
DaratumumabTrastuzumab may increase the cardiotoxic activities of Daratumumab.Approved
DasatinibTrastuzumab may increase the cardiotoxic activities of Dasatinib.Approved, Investigational
DaunorubicinTrastuzumab may increase the cardiotoxic activities of Daunorubicin.Approved
DecitabineTrastuzumab may increase the cardiotoxic activities of Decitabine.Approved, Investigational
Denileukin diftitoxTrastuzumab may increase the cardiotoxic activities of Denileukin diftitox.Approved, Investigational
DeoxyspergualinTrastuzumab may increase the cardiotoxic activities of Deoxyspergualin.Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Trastuzumab.Approved
DexamethasoneTrastuzumab may increase the cardiotoxic activities of Dexamethasone.Approved, Investigational, Vet Approved
DexrazoxaneTrastuzumab may increase the cardiotoxic activities of Dexrazoxane.Approved, Withdrawn
DienogestTrastuzumab may increase the cardiotoxic activities of Dienogest.Approved
DiethylstilbestrolTrastuzumab may increase the cardiotoxic activities of Diethylstilbestrol.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Trastuzumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Trastuzumab.Approved
DiindolylmethaneTrastuzumab may increase the cardiotoxic activities of Diindolylmethane.Investigational
Dimethyl fumarateTrastuzumab may increase the neutropenic activities of Dimethyl fumarate.Approved, Investigational
DinutuximabTrastuzumab may increase the cardiotoxic activities of Dinutuximab.Approved
DocetaxelTrastuzumab may increase the cardiotoxic activities of Docetaxel.Approved, Investigational
DoxifluridineTrastuzumab may increase the cardiotoxic activities of Doxifluridine.Investigational
DoxorubicinTrastuzumab may increase the cardiotoxic activities of Doxorubicin.Approved, Investigational
EcabetTrastuzumab may increase the cardiotoxic activities of Ecabet.Approved, Investigational
EculizumabTrastuzumab may increase the neutropenic activities of Eculizumab.Approved, Investigational
EfalizumabTrastuzumab may increase the neutropenic activities of Efalizumab.Approved, Investigational
efaproxiralTrastuzumab may increase the cardiotoxic activities of efaproxiral.Investigational
EflornithineTrastuzumab may increase the cardiotoxic activities of Eflornithine.Approved, Withdrawn
EG009Trastuzumab may increase the cardiotoxic activities of EG009.Investigational
ElsamitrucinTrastuzumab may increase the cardiotoxic activities of Elsamitrucin.Investigational
EndostatinTrastuzumab may increase the cardiotoxic activities of Endostatin.Investigational
EnoxacinTrastuzumab may increase the cardiotoxic activities of Enoxacin.Approved
EnrofloxacinTrastuzumab may increase the cardiotoxic activities of Enrofloxacin.Vet Approved
EntinostatTrastuzumab may increase the cardiotoxic activities of Entinostat.Investigational
EpirubicinTrastuzumab may increase the cardiotoxic activities of Epirubicin.Approved
EpofolateTrastuzumab may increase the cardiotoxic activities of Epofolate.Investigational
Epothilone BTrastuzumab may increase the cardiotoxic activities of Epothilone B.Experimental, Investigational
EribulinTrastuzumab may increase the cardiotoxic activities of Eribulin.Approved, Investigational
ErlotinibTrastuzumab may increase the cardiotoxic activities of Erlotinib.Approved, Investigational
EstramustineTrastuzumab may increase the cardiotoxic activities of Estramustine.Approved
EtanerceptTrastuzumab may increase the neutropenic activities of Etanercept.Approved, Investigational
EtanidazoleTrastuzumab may increase the cardiotoxic activities of Etanidazole.Investigational
Ethiodized oilTrastuzumab may increase the cardiotoxic activities of Ethiodized oil.Approved
Ethyl carbamateTrastuzumab may increase the cardiotoxic activities of Ethyl carbamate.Withdrawn
EtoposideTrastuzumab may increase the cardiotoxic activities of Etoposide.Approved
EverolimusTrastuzumab may increase the cardiotoxic activities of Everolimus.Approved
ExatecanTrastuzumab may increase the cardiotoxic activities of Exatecan.Investigational
ExemestaneTrastuzumab may increase the cardiotoxic activities of Exemestane.Approved, Investigational
exisulindTrastuzumab may increase the cardiotoxic activities of exisulind.Investigational
FenretinideTrastuzumab may increase the cardiotoxic activities of Fenretinide.Investigational
FiacitabineTrastuzumab may increase the cardiotoxic activities of Fiacitabine.Investigational
FingolimodTrastuzumab may increase the neutropenic activities of Fingolimod.Approved, Investigational
FlavopiridolTrastuzumab may increase the cardiotoxic activities of Flavopiridol.Experimental, Investigational
FleroxacinTrastuzumab may increase the cardiotoxic activities of Fleroxacin.Approved
FloxuridineTrastuzumab may increase the cardiotoxic activities of Floxuridine.Approved
FludarabineTrastuzumab may increase the cardiotoxic activities of Fludarabine.Approved
FludrocortisoneTrastuzumab may increase the neutropenic activities of Fludrocortisone.Approved
FlumequineTrastuzumab may increase the cardiotoxic activities of Flumequine.Withdrawn
FluorouracilTrastuzumab may increase the cardiotoxic activities of Fluorouracil.Approved
FlutamideTrastuzumab may increase the cardiotoxic activities of Flutamide.Approved
FormestaneTrastuzumab may increase the cardiotoxic activities of Formestane.Approved, Investigational, Withdrawn
FormycinTrastuzumab may increase the cardiotoxic activities of Formycin.Experimental
FotemustineTrastuzumab may increase the cardiotoxic activities of Fotemustine.Experimental
FulvestrantTrastuzumab may increase the cardiotoxic activities of Fulvestrant.Approved, Investigational
FumagillinTrastuzumab may increase the cardiotoxic activities of Fumagillin.Experimental
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Trastuzumab.Investigational
Gallium nitrateTrastuzumab may increase the cardiotoxic activities of Gallium nitrate.Approved, Investigational
GarenoxacinTrastuzumab may increase the cardiotoxic activities of Garenoxacin.Investigational
GatifloxacinTrastuzumab may increase the cardiotoxic activities of Gatifloxacin.Approved, Investigational
GefitinibTrastuzumab may increase the cardiotoxic activities of Gefitinib.Approved, Investigational
GeldanamycinTrastuzumab may increase the cardiotoxic activities of Geldanamycin.Experimental
GemcitabineTrastuzumab may increase the cardiotoxic activities of Gemcitabine.Approved
GemifloxacinTrastuzumab may increase the cardiotoxic activities of Gemifloxacin.Approved, Investigational
Gemtuzumab ozogamicinTrastuzumab may increase the cardiotoxic activities of Gemtuzumab ozogamicin.Approved, Investigational, Withdrawn
GenisteinTrastuzumab may increase the cardiotoxic activities of Genistein.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Trastuzumab.Investigational
Ginsenoside CTrastuzumab may increase the cardiotoxic activities of Ginsenoside C.Nutraceutical
Glatiramer AcetateTrastuzumab may increase the neutropenic activities of Glatiramer Acetate.Approved, Investigational
GlimepirideTrastuzumab may increase the neutropenic activities of Glimepiride.Approved
GolimumabTrastuzumab may increase the neutropenic activities of Golimumab.Approved
GoserelinTrastuzumab may increase the cardiotoxic activities of Goserelin.Approved
GrepafloxacinTrastuzumab may increase the cardiotoxic activities of Grepafloxacin.Withdrawn
GusperimusTrastuzumab may increase the cardiotoxic activities of Gusperimus.Investigational
HadacidinTrastuzumab may increase the cardiotoxic activities of Hadacidin.Experimental
HalofuginoneTrastuzumab may increase the cardiotoxic activities of Halofuginone.Investigational, Vet Approved
HexestrolTrastuzumab may increase the cardiotoxic activities of Hexestrol.Withdrawn
HydrocortisoneTrastuzumab may increase the neutropenic activities of Hydrocortisone.Approved, Vet Approved
Hydroxyprogesterone caproateTrastuzumab may increase the cardiotoxic activities of Hydroxyprogesterone caproate.Approved
HydroxyureaTrastuzumab may increase the cardiotoxic activities of Hydroxyurea.Approved
Ibritumomab tiuxetanTrastuzumab may increase the neutropenic activities of Ibritumomab tiuxetan.Approved
IbrutinibTrastuzumab may increase the cardiotoxic activities of Ibrutinib.Approved
IcatibantTrastuzumab may increase the neutropenic activities of Icatibant.Approved
IdarubicinTrastuzumab may increase the cardiotoxic activities of Idarubicin.Approved
IdelalisibTrastuzumab may increase the cardiotoxic activities of Idelalisib.Approved
IfosfamideTrastuzumab may increase the cardiotoxic activities of Ifosfamide.Approved
Il 4Trastuzumab may increase the cardiotoxic activities of Il 4.Investigational
ImatinibTrastuzumab may increase the cardiotoxic activities of Imatinib.Approved
ImiquimodTrastuzumab may increase the cardiotoxic activities of Imiquimod.Approved, Investigational
IndirubinTrastuzumab may increase the cardiotoxic activities of Indirubin.Investigational
InfliximabTrastuzumab may increase the neutropenic activities of Infliximab.Approved
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Trastuzumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Trastuzumab.Investigational
Interferon beta-1aTrastuzumab may increase the cardiotoxic activities of Interferon beta-1a.Approved, Investigational
Interferon beta-1bTrastuzumab may increase the cardiotoxic activities of Interferon beta-1b.Approved
IobenguaneTrastuzumab may increase the cardiotoxic activities of Iobenguane.Approved
IpilimumabTrastuzumab may increase the cardiotoxic activities of Ipilimumab.Approved
IrinotecanTrastuzumab may increase the cardiotoxic activities of Irinotecan.Approved, Investigational
IrofulvenTrastuzumab may increase the cardiotoxic activities of Irofulven.Investigational
IxabepiloneTrastuzumab may increase the cardiotoxic activities of Ixabepilone.Approved, Investigational
IxazomibTrastuzumab may increase the cardiotoxic activities of Ixazomib.Approved
KOS-1584Trastuzumab may increase the cardiotoxic activities of KOS-1584.Investigational
L-alanosineTrastuzumab may increase the cardiotoxic activities of L-alanosine.Investigational
L-PhenylalanineTrastuzumab may increase the neutropenic activities of L-Phenylalanine.Approved, Nutraceutical
LanreotideTrastuzumab may increase the cardiotoxic activities of Lanreotide.Approved
LapatinibTrastuzumab may increase the cardiotoxic activities of Lapatinib.Approved, Investigational
LeflunomideTrastuzumab may increase the cardiotoxic activities of Leflunomide.Approved, Investigational
LenalidomideTrastuzumab may increase the cardiotoxic activities of Lenalidomide.Approved
LenvatinibTrastuzumab may increase the cardiotoxic activities of Lenvatinib.Approved
LetrozoleTrastuzumab may increase the cardiotoxic activities of Letrozole.Approved, Investigational
LeuprolideTrastuzumab may increase the cardiotoxic activities of Leuprolide.Approved, Investigational
LevofloxacinTrastuzumab may increase the cardiotoxic activities of Levofloxacin.Approved, Investigational
LiarozoleTrastuzumab may increase the cardiotoxic activities of Liarozole.Investigational
LisofyllineTrastuzumab may increase the neutropenic activities of Lisofylline.Investigational
LomefloxacinTrastuzumab may increase the cardiotoxic activities of Lomefloxacin.Approved
LomustineTrastuzumab may increase the cardiotoxic activities of Lomustine.Approved
LonidamineTrastuzumab may increase the cardiotoxic activities of Lonidamine.Approved, Investigational
Lx211Trastuzumab may increase the neutropenic activities of Lx211.Investigational
Ly2801653Trastuzumab may increase the cardiotoxic activities of Ly2801653.Investigational
LycopeneTrastuzumab may increase the cardiotoxic activities of Lycopene.Approved
MafosfamideTrastuzumab may increase the cardiotoxic activities of Mafosfamide.Investigational
MasitinibTrastuzumab may increase the cardiotoxic activities of Masitinib.Vet Approved
MasoprocolTrastuzumab may increase the cardiotoxic activities of Masoprocol.Approved
MaxacalcitolTrastuzumab may increase the cardiotoxic activities of Maxacalcitol.Approved
MDX-1106Trastuzumab may increase the cardiotoxic activities of MDX-1106.Investigational
MebendazoleTrastuzumab may increase the cardiotoxic activities of Mebendazole.Approved, Vet Approved
MechlorethamineTrastuzumab may increase the cardiotoxic activities of Mechlorethamine.Approved
MedrogestoneTrastuzumab may increase the cardiotoxic activities of Medrogestone.Approved
Medroxyprogesterone acetateTrastuzumab may increase the cardiotoxic activities of Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateTrastuzumab may increase the cardiotoxic activities of Megestrol acetate.Approved, Vet Approved
MelphalanTrastuzumab may increase the cardiotoxic activities of Melphalan.Approved
MepolizumabTrastuzumab may increase the neutropenic activities of Mepolizumab.Approved, Investigational
MequinolTrastuzumab may increase the cardiotoxic activities of Mequinol.Approved
MercaptopurineTrastuzumab may increase the cardiotoxic activities of Mercaptopurine.Approved
MethotrexateTrastuzumab may increase the cardiotoxic activities of Methotrexate.Approved
Methyl aminolevulinateTrastuzumab may increase the cardiotoxic activities of Methyl aminolevulinate.Approved
MethylprednisoloneTrastuzumab may increase the cardiotoxic activities of Methylprednisolone.Approved, Vet Approved
MethyltestosteroneTrastuzumab may increase the cardiotoxic activities of Methyltestosterone.Approved
MGI-114Trastuzumab may increase the cardiotoxic activities of MGI-114.Investigational
MidostaurinTrastuzumab may increase the cardiotoxic activities of Midostaurin.Investigational
MiltefosineTrastuzumab may increase the cardiotoxic activities of Miltefosine.Approved
MisonidazoleTrastuzumab may increase the cardiotoxic activities of Misonidazole.Investigational
MitoguazoneTrastuzumab may increase the cardiotoxic activities of Mitoguazone.Investigational
MitolactolTrastuzumab may increase the cardiotoxic activities of Mitolactol.Investigational
MitomycinTrastuzumab may increase the cardiotoxic activities of Mitomycin.Approved
MitotaneTrastuzumab may increase the cardiotoxic activities of Mitotane.Approved
MitoxantroneTrastuzumab may increase the cardiotoxic activities of Mitoxantrone.Approved, Investigational
MizoribineTrastuzumab may increase the cardiotoxic activities of Mizoribine.Investigational
MLN576Trastuzumab may increase the cardiotoxic activities of MLN576.Investigational
MolgramostimTrastuzumab may increase the cardiotoxic activities of Molgramostim.Investigational
motexafin gadoliniumTrastuzumab may increase the cardiotoxic activities of motexafin gadolinium.Investigational
MoxifloxacinTrastuzumab may increase the cardiotoxic activities of Moxifloxacin.Approved, Investigational
MuromonabTrastuzumab may increase the neutropenic activities of Muromonab.Approved, Investigational
Mycophenolate mofetilTrastuzumab may increase the neutropenic activities of Mycophenolate mofetil.Approved, Investigational
Mycophenolic acidTrastuzumab may increase the cardiotoxic activities of Mycophenolic acid.Approved
NafamostatTrastuzumab may increase the neutropenic activities of Nafamostat.Investigational
Nalidixic AcidTrastuzumab may increase the cardiotoxic activities of Nalidixic Acid.Approved
NamitecanTrastuzumab may increase the cardiotoxic activities of Namitecan.Investigational
NatalizumabTrastuzumab may increase the neutropenic activities of Natalizumab.Approved, Investigational
NavitoclaxTrastuzumab may increase the cardiotoxic activities of Navitoclax.Investigational
NecitumumabTrastuzumab may increase the cardiotoxic activities of Necitumumab.Approved
NelarabineTrastuzumab may increase the cardiotoxic activities of Nelarabine.Approved, Investigational
NiguldipineTrastuzumab may increase the cardiotoxic activities of Niguldipine.Experimental
NilotinibTrastuzumab may increase the cardiotoxic activities of Nilotinib.Approved, Investigational
NilutamideTrastuzumab may increase the cardiotoxic activities of Nilutamide.Approved
NimustineTrastuzumab may increase the cardiotoxic activities of Nimustine.Investigational
NintedanibTrastuzumab may increase the cardiotoxic activities of Nintedanib.Approved
NivolumabTrastuzumab may increase the cardiotoxic activities of Nivolumab.Approved
Nk012Trastuzumab may increase the cardiotoxic activities of Nk012.Investigational
nocodazoleTrastuzumab may increase the cardiotoxic activities of nocodazole.Experimental
NolatrexedTrastuzumab may increase the cardiotoxic activities of Nolatrexed.Investigational
NorfloxacinTrastuzumab may increase the cardiotoxic activities of Norfloxacin.Approved
ObinutuzumabTrastuzumab may increase the cardiotoxic activities of Obinutuzumab.Approved
OctreotideTrastuzumab may increase the cardiotoxic activities of Octreotide.Approved, Investigational
OfatumumabTrastuzumab may increase the cardiotoxic activities of Ofatumumab.Approved
OfloxacinTrastuzumab may increase the cardiotoxic activities of Ofloxacin.Approved
OlaparibTrastuzumab may increase the cardiotoxic activities of Olaparib.Approved
Omacetaxine mepesuccinateTrastuzumab may increase the cardiotoxic activities of Omacetaxine mepesuccinate.Approved
OprelvekinTrastuzumab may increase the cardiotoxic activities of Oprelvekin.Approved, Investigational
OsimertinibTrastuzumab may increase the cardiotoxic activities of Osimertinib.Approved
OuabainOuabain may decrease the cardiotoxic activities of Trastuzumab.Approved
OxaliplatinTrastuzumab may increase the cardiotoxic activities of Oxaliplatin.Approved, Investigational
PaclitaxelTrastuzumab may increase the cardiotoxic activities of Paclitaxel.Approved, Vet Approved
PaclitaxelThe serum concentration of Paclitaxel can be decreased when it is combined with Trastuzumab.Approved, Vet Approved
PalbociclibTrastuzumab may increase the cardiotoxic activities of Palbociclib.Approved
PalifosfamideTrastuzumab may increase the cardiotoxic activities of Palifosfamide.Investigational
PamidronateTrastuzumab may increase the cardiotoxic activities of Pamidronate.Approved
PanitumumabTrastuzumab may increase the cardiotoxic activities of Panitumumab.Approved, Investigational
PanobinostatTrastuzumab may increase the cardiotoxic activities of Panobinostat.Approved, Investigational
PARP inhibitorTrastuzumab may increase the cardiotoxic activities of PARP inhibitor.Investigational
PazopanibTrastuzumab may increase the cardiotoxic activities of Pazopanib.Approved
PazufloxacinTrastuzumab may increase the cardiotoxic activities of Pazufloxacin.Investigational
PefloxacinTrastuzumab may increase the cardiotoxic activities of Pefloxacin.Approved
PegaspargaseTrastuzumab may increase the cardiotoxic activities of Pegaspargase.Approved, Investigational
PembrolizumabTrastuzumab may increase the cardiotoxic activities of Pembrolizumab.Approved
PemetrexedTrastuzumab may increase the cardiotoxic activities of Pemetrexed.Approved, Investigational
PenclomedineTrastuzumab may increase the cardiotoxic activities of Penclomedine.Investigational
PentostatinTrastuzumab may increase the cardiotoxic activities of Pentostatin.Approved, Investigational
PertuzumabTrastuzumab may increase the cardiotoxic activities of Pertuzumab.Approved
Phenylacetic acidTrastuzumab may increase the cardiotoxic activities of Phenylacetic acid.Approved
PimecrolimusTrastuzumab may increase the neutropenic activities of Pimecrolimus.Approved, Investigational
PipobromanTrastuzumab may increase the cardiotoxic activities of Pipobroman.Approved
PirarubicinTrastuzumab may increase the cardiotoxic activities of Pirarubicin.Investigational
PirfenidoneTrastuzumab may increase the cardiotoxic activities of Pirfenidone.Investigational
PirlindoleTrastuzumab may increase the cardiotoxic activities of Pirlindole.Approved
PixantroneTrastuzumab may increase the cardiotoxic activities of Pixantrone.Investigational
PlevitrexedTrastuzumab may increase the cardiotoxic activities of Plevitrexed.Investigational
PlicamycinTrastuzumab may increase the cardiotoxic activities of Plicamycin.Approved, Withdrawn
PodofiloxTrastuzumab may increase the cardiotoxic activities of Podofilox.Approved
PodophyllinTrastuzumab may increase the cardiotoxic activities of Podophyllin.Approved
polyacrylic acidTrastuzumab may increase the cardiotoxic activities of polyacrylic acid.Investigational
PomalidomideTrastuzumab may increase the cardiotoxic activities of Pomalidomide.Approved
PonatinibTrastuzumab may increase the cardiotoxic activities of Ponatinib.Approved
PorfimerTrastuzumab may increase the cardiotoxic activities of Porfimer.Approved, Investigational
porfiromycinTrastuzumab may increase the cardiotoxic activities of porfiromycin.Investigational
PralatrexateTrastuzumab may increase the cardiotoxic activities of Pralatrexate.Approved
PrednimustineTrastuzumab may increase the cardiotoxic activities of Prednimustine.Investigational
PrednisoloneTrastuzumab may increase the cardiotoxic activities of Prednisolone.Approved, Vet Approved
PrednisoneTrastuzumab may increase the cardiotoxic activities of Prednisone.Approved, Vet Approved
ProcarbazineTrastuzumab may increase the cardiotoxic activities of Procarbazine.Approved
Purine RibosideTrastuzumab may increase the cardiotoxic activities of Purine Riboside.Experimental
PuromycinTrastuzumab may increase the cardiotoxic activities of Puromycin.Experimental
PyrazoloacridineTrastuzumab may increase the cardiotoxic activities of Pyrazoloacridine.Investigational
Qlt091001Trastuzumab may increase the cardiotoxic activities of Qlt091001.Investigational
QuinacrineTrastuzumab may increase the cardiotoxic activities of Quinacrine.Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Trastuzumab.Approved
Radium Ra 223 DichlorideTrastuzumab may increase the cardiotoxic activities of Radium Ra 223 Dichloride.Approved, Investigational
RaltitrexedTrastuzumab may increase the cardiotoxic activities of Raltitrexed.Approved, Investigational
RamucirumabTrastuzumab may increase the cardiotoxic activities of Ramucirumab.Approved, Investigational
RanibizumabTrastuzumab may increase the cardiotoxic activities of Ranibizumab.Approved
RanpirnaseTrastuzumab may increase the cardiotoxic activities of Ranpirnase.Investigational
RegorafenibTrastuzumab may increase the cardiotoxic activities of Regorafenib.Approved
ResveratrolTrastuzumab may increase the cardiotoxic activities of Resveratrol.Experimental, Investigational
Rhodamine 6GTrastuzumab may increase the cardiotoxic activities of Rhodamine 6G.Experimental
RilonaceptTrastuzumab may increase the neutropenic activities of Rilonacept.Approved
RituximabTrastuzumab may increase the cardiotoxic activities of Rituximab.Approved
RomidepsinTrastuzumab may increase the cardiotoxic activities of Romidepsin.Approved, Investigational
RomiplostimTrastuzumab may increase the cardiotoxic activities of Romiplostim.Approved
RoquinimexTrastuzumab may increase the cardiotoxic activities of Roquinimex.Investigational
RubitecanTrastuzumab may increase the cardiotoxic activities of Rubitecan.Investigational
RucaparibTrastuzumab may increase the cardiotoxic activities of Rucaparib.Investigational
RuxolitinibTrastuzumab may increase the cardiotoxic activities of Ruxolitinib.Approved
SalirasibTrastuzumab may increase the cardiotoxic activities of Salirasib.Investigational
SaracatinibTrastuzumab may increase the cardiotoxic activities of Saracatinib.Investigational
SatraplatinTrastuzumab may increase the cardiotoxic activities of Satraplatin.Investigational
SecukinumabTrastuzumab may increase the neutropenic activities of Secukinumab.Approved
SeliciclibTrastuzumab may increase the cardiotoxic activities of Seliciclib.Investigational
SemaxanibTrastuzumab may increase the cardiotoxic activities of Semaxanib.Investigational
SeocalcitolTrastuzumab may increase the cardiotoxic activities of Seocalcitol.Experimental
SiltuximabTrastuzumab may increase the cardiotoxic activities of Siltuximab.Approved
SirolimusTrastuzumab may increase the cardiotoxic activities of Sirolimus.Approved, Investigational
Sodium phenylbutyrateTrastuzumab may increase the cardiotoxic activities of Sodium phenylbutyrate.Approved
SonidegibTrastuzumab may increase the cardiotoxic activities of Sonidegib.Approved, Investigational
SonifilanTrastuzumab may increase the cardiotoxic activities of Sonifilan.Investigational
SorafenibTrastuzumab may increase the cardiotoxic activities of Sorafenib.Approved, Investigational
SparfloxacinTrastuzumab may increase the cardiotoxic activities of Sparfloxacin.Approved
Sparfosic acidTrastuzumab may increase the cardiotoxic activities of Sparfosic acid.Experimental
SparsomycinTrastuzumab may increase the cardiotoxic activities of Sparsomycin.Experimental
squalamineTrastuzumab may increase the cardiotoxic activities of squalamine.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Trastuzumab.Investigational
SRT501Trastuzumab may increase the cardiotoxic activities of SRT501.Investigational
SteproninTrastuzumab may increase the neutropenic activities of Stepronin.Approved
StreptozocinTrastuzumab may increase the cardiotoxic activities of Streptozocin.Approved
SulforaphaneTrastuzumab may increase the cardiotoxic activities of Sulforaphane.Investigational
SulindacTrastuzumab may increase the cardiotoxic activities of Sulindac.Approved
SunitinibTrastuzumab may increase the cardiotoxic activities of Sunitinib.Approved, Investigational
SuraminTrastuzumab may increase the cardiotoxic activities of Suramin.Approved
SwainsonineTrastuzumab may increase the cardiotoxic activities of Swainsonine.Experimental
TacrolimusTrastuzumab may increase the neutropenic activities of Tacrolimus.Approved, Investigational
TalaporfinTrastuzumab may increase the cardiotoxic activities of Talaporfin.Investigational
TamoxifenTrastuzumab may increase the cardiotoxic activities of Tamoxifen.Approved
TegafurTrastuzumab may increase the cardiotoxic activities of Tegafur.Approved
TemafloxacinTrastuzumab may increase the cardiotoxic activities of Temafloxacin.Withdrawn
TemoporfinTrastuzumab may increase the cardiotoxic activities of Temoporfin.Approved
TemozolomideTrastuzumab may increase the cardiotoxic activities of Temozolomide.Approved, Investigational
TemsirolimusTrastuzumab may increase the cardiotoxic activities of Temsirolimus.Approved
TeniposideTrastuzumab may increase the cardiotoxic activities of Teniposide.Approved
TepoxalinTrastuzumab may increase the neutropenic activities of Tepoxalin.Vet Approved
TeriflunomideTrastuzumab may increase the neutropenic activities of Teriflunomide.Approved
TestolactoneTrastuzumab may increase the cardiotoxic activities of Testolactone.Approved
TetrathiomolybdateTrastuzumab may increase the cardiotoxic activities of Tetrathiomolybdate.Investigational
TezacitabineTrastuzumab may increase the cardiotoxic activities of Tezacitabine.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Trastuzumab.Investigational
ThalidomideTrastuzumab may increase the cardiotoxic activities of Thalidomide.Approved, Investigational, Withdrawn
ThiotepaTrastuzumab may increase the cardiotoxic activities of Thiotepa.Approved
ThymalfasinTrastuzumab may increase the cardiotoxic activities of Thymalfasin.Approved, Investigational
TiboloneTrastuzumab may increase the cardiotoxic activities of Tibolone.Approved
TioguanineTrastuzumab may increase the cardiotoxic activities of Tioguanine.Approved
TipifarnibTrastuzumab may increase the cardiotoxic activities of Tipifarnib.Investigational
TirapazamineTrastuzumab may increase the cardiotoxic activities of Tirapazamine.Investigational
TivozanibTrastuzumab may increase the cardiotoxic activities of Tivozanib.Investigational
Tnp 470Trastuzumab may increase the cardiotoxic activities of Tnp 470.Investigational
TocilizumabTrastuzumab may increase the neutropenic activities of Tocilizumab.Approved
TofacitinibTrastuzumab may increase the neutropenic activities of Tofacitinib.Approved, Investigational
TopotecanTrastuzumab may increase the cardiotoxic activities of Topotecan.Approved, Investigational
ToremifeneTrastuzumab may increase the cardiotoxic activities of Toremifene.Approved, Investigational
TositumomabTrastuzumab may increase the cardiotoxic activities of Tositumomab.Approved
TositumomabTrastuzumab may increase the neutropenic activities of Tositumomab.Approved
TrabectedinTrastuzumab may increase the cardiotoxic activities of Trabectedin.Approved, Investigational
TrametinibTrastuzumab may increase the cardiotoxic activities of Trametinib.Approved
Trastuzumab emtansineTrastuzumab may increase the cardiotoxic activities of Trastuzumab emtansine.Approved
TreosulfanTrastuzumab may increase the cardiotoxic activities of Treosulfan.Investigational
TretazicarTrastuzumab may increase the cardiotoxic activities of Tretazicar.Investigational
TretinoinTrastuzumab may increase the cardiotoxic activities of Tretinoin.Approved, Investigational, Nutraceutical
TriamcinoloneTrastuzumab may increase the neutropenic activities of Triamcinolone.Approved, Vet Approved
TrifluridineTrastuzumab may increase the cardiotoxic activities of Trifluridine.Approved
TrilostaneTrastuzumab may increase the cardiotoxic activities of Trilostane.Approved, Investigational, Vet Approved, Withdrawn
TrimetrexateTrastuzumab may increase the cardiotoxic activities of Trimetrexate.Approved, Investigational
TriptorelinTrastuzumab may increase the cardiotoxic activities of Triptorelin.Approved, Vet Approved
TrofosfamideTrastuzumab may increase the cardiotoxic activities of Trofosfamide.Investigational
TrovafloxacinTrastuzumab may increase the cardiotoxic activities of Trovafloxacin.Approved, Withdrawn
TroxacitabineTrastuzumab may increase the cardiotoxic activities of Troxacitabine.Investigational
TTNPBTrastuzumab may increase the cardiotoxic activities of TTNPB.Experimental
TubercidinTrastuzumab may increase the cardiotoxic activities of Tubercidin.Experimental
UbenimexTrastuzumab may increase the cardiotoxic activities of Ubenimex.Experimental
Uracil mustardTrastuzumab may increase the cardiotoxic activities of Uracil mustard.Approved
UstekinumabTrastuzumab may increase the neutropenic activities of Ustekinumab.Approved, Investigational
VadimezanTrastuzumab may increase the cardiotoxic activities of Vadimezan.Investigational
Val 083Trastuzumab may increase the cardiotoxic activities of Val 083.Investigational
ValrubicinTrastuzumab may increase the cardiotoxic activities of Valrubicin.Approved
VandetanibTrastuzumab may increase the cardiotoxic activities of Vandetanib.Approved
VapreotideTrastuzumab may increase the cardiotoxic activities of Vapreotide.Approved, Investigational
VedolizumabTrastuzumab may increase the neutropenic activities of Vedolizumab.Approved
VeliparibTrastuzumab may increase the cardiotoxic activities of Veliparib.Investigational
VemurafenibTrastuzumab may increase the cardiotoxic activities of Vemurafenib.Approved
VerteporfinTrastuzumab may increase the cardiotoxic activities of Verteporfin.Approved, Investigational
VesnarinoneTrastuzumab may increase the cardiotoxic activities of Vesnarinone.Investigational
VilanterolTrastuzumab may increase the neutropenic activities of Vilanterol.Approved
VinblastineTrastuzumab may increase the cardiotoxic activities of Vinblastine.Approved
VincristineTrastuzumab may increase the cardiotoxic activities of Vincristine.Approved, Investigational
VindesineTrastuzumab may increase the cardiotoxic activities of Vindesine.Approved
VinflunineTrastuzumab may increase the cardiotoxic activities of Vinflunine.Approved
VinorelbineTrastuzumab may increase the cardiotoxic activities of Vinorelbine.Approved, Investigational
VintafolideTrastuzumab may increase the cardiotoxic activities of Vintafolide.Investigational
VismodegibTrastuzumab may increase the cardiotoxic activities of Vismodegib.Approved
Vitamin ATrastuzumab may increase the cardiotoxic activities of Vitamin A.Approved, Nutraceutical, Vet Approved
VorinostatTrastuzumab may increase the cardiotoxic activities of Vorinostat.Approved, Investigational
ZorubicinTrastuzumab may increase the cardiotoxic activities of Zorubicin.Experimental
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Bange J, Zwick E, Ullrich A: Molecular targets for breast cancer therapy and prevention. Nat Med. 2001 May;7(5):548-52. [PubMed:11329054 ]
  2. Menard S, Pupa SM, Campiglio M, Tagliabue E: Biologic and therapeutic role of HER2 in cancer. Oncogene. 2003 Sep 29;22(42):6570-8. [PubMed:14528282 ]
  3. Kute T, Lack CM, Willingham M, Bishwokama B, Williams H, Barrett K, Mitchell T, Vaughn JP: Development of Herceptin resistance in breast cancer cells. Cytometry A. 2004 Feb;57(2):86-93. [PubMed:14750129 ]
  4. Albanell J, Codony J, Rovira A, Mellado B, Gascon P: Mechanism of action of anti-HER2 monoclonal antibodies: scientific update on trastuzumab and 2C4. Adv Exp Med Biol. 2003;532:253-68. [PubMed:12908564 ]
  5. Tan AR, Swain SM: Ongoing adjuvant trials with trastuzumab in breast cancer. Semin Oncol. 2003 Oct;30(5 Suppl 16):54-64. [PubMed:14613027 ]
  6. Nebija D, Kopelent-Frank H, Urban E, Noe CR, Lachmann B: Comparison of two-dimensional gel electrophoresis patterns and MALDI-TOF MS analysis of therapeutic recombinant monoclonal antibodies trastuzumab and rituximab. J Pharm Biomed Anal. 2011 Dec 5;56(4):684-91. doi: 10.1016/j.jpba.2011.07.006. Epub 2011 Jul 18. [PubMed:21813259 ]
External Links
ATC CodesL01XC03
AHFS CodesNot Available
PDB Entries
FDA labelDownload (41 KB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous150 mg
Injection, solutionSubcutaneous600 mg
Kit
Powder, for solutionIntravenous440 mg
Kit; powder, for solution; solutionIntravenous
Prices
Unit descriptionCostUnit
Herceptin 440 mg Solution Vial3581.2USD vial
Herceptin 440 mg vial3443.46USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2103059 No2005-03-222012-06-15Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.415Not Available
isoelectric point8.45Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Transmembrane signaling receptor activity
Specific Function:
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-...
Gene Name:
ERBB2
Uniprot ID:
P04626
Molecular Weight:
137909.27 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Leveque D, Gigou L, Bergerat JP: Clinical pharmacology of trastuzumab. Curr Clin Pharmacol. 2008 Jan;3(1):51-5. [PubMed:18690878 ]
  3. Lin A, Rugo HS: The role of trastuzumab in early stage breast cancer: current data and treatment recommendations. Curr Treat Options Oncol. 2007 Feb;8(1):47-60. [PubMed:17660958 ]
  4. Treish I, Schwartz R, Lindley C: Pharmacology and therapeutic use of trastuzumab in breast cancer. Am J Health Syst Pharm. 2000 Nov 15;57(22):2063-76; quiz 2077-9. [PubMed:11098307 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Ubiquitin protein ligase binding
Specific Function:
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on ke...
Gene Name:
EGFR
Uniprot ID:
P00533
Molecular Weight:
134276.185 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Curnow RT: Clinical experience with CD64-directed immunotherapy. An overview. Cancer Immunol Immunother. 1997 Nov-Dec;45(3-4):210-5. [PubMed:9435876 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Bowles JA, Weiner GJ: CD16 polymorphisms and NK activation induced by monoclonal antibody-coated target cells. J Immunol Methods. 2005 Sep;304(1-2):88-99. [PubMed:16109421 ]
  2. Shahied LS, Tang Y, Alpaugh RK, Somer R, Greenspon D, Weiner LM: Bispecific minibodies targeting HER2/neu and CD16 exhibit improved tumor lysis when placed in a divalent tumor antigen binding format. J Biol Chem. 2004 Dec 24;279(52):53907-14. Epub 2004 Oct 7. [PubMed:15471859 ]
  3. Kubo M, Morisaki T, Kuroki H, Tasaki A, Yamanaka N, Matsumoto K, Nakamura K, Onishi H, Baba E, Katano M: Combination of adoptive immunotherapy with Herceptin for patients with HER2-expressing breast cancer. Anticancer Res. 2003 Nov-Dec;23(6a):4443-9. [PubMed:14666732 ]
  4. Yamaguchi Y, Hironaka K, Okawaki M, Okita R, Matsuura K, Ohshita A, Toge T: HER2-specific cytotoxic activity of lymphokine-activated killer cells in the presence of trastuzumab. Anticancer Res. 2005 Mar-Apr;25(2A):827-32. [PubMed:15868915 ]
  5. Xie Z, Guo N, Yu M, Hu M, Shen B: A new format of bispecific antibody: highly efficient heterodimerization, expression and tumor cell lysis. J Immunol Methods. 2005 Jan;296(1-2):95-101. Epub 2004 Nov 19. [PubMed:15680154 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Suzuki E, Niwa R, Saji S, Muta M, Hirose M, Iida S, Shiotsu Y, Satoh M, Shitara K, Kondo M, Toi M: A nonfucosylated anti-HER2 antibody augments antibody-dependent cellular cytotoxicity in breast cancer patients. Clin Cancer Res. 2007 Mar 15;13(6):1875-82. [PubMed:17363544 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Oxygen binding
Specific Function:
Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
Gene Name:
CYP19A1
Uniprot ID:
P11511
Molecular Weight:
57882.48 Da
References
  1. Preissner S, Kroll K, Dunkel M, Senger C, Goldsobel G, Kuzman D, Guenther S, Winnenburg R, Schroeder M, Preissner R: SuperCYP: a comprehensive database on Cytochrome P450 enzymes including a tool for analysis of CYP-drug interactions. Nucleic Acids Res. 2010 Jan;38(Database issue):D237-43. doi: 10.1093/nar/gkp970. Epub 2009 Nov 24. [PubMed:19934256 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23