Identification

Name
Trastuzumab
Accession Number
DB00072  (BTD00098, BIOD00098)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

A recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture.

Protein structure
Db00072
Protein chemical formula
C6470H10012N1726O2013S42
Protein average weight
145531.5 Da
Sequences
>Anti-HER2 Light chain (1 and 2)
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Anti-HER2 Heavy chain (1 and 2)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • Anti HER2
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HerceptinPowder, for solution440 mgIntravenousHoffmann La Roche1999-08-23Not applicableCanada
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Limited2000-08-28Not applicableEu
HerceptinKitGenentech, Inc.1998-09-25Not applicableUs
HerceptinKitGenentech, Inc.1998-09-25Not applicableUs
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Limited2000-08-28Not applicableEu
HerceptinInjection, powder, for solution150 mgIntravenousRoche Registration Limited2000-08-28Not applicableEu
HerceptinInjection, powder, lyophilized, for solution150 mg/7.4mLIntravenousGenentech, Inc.2017-02-10Not applicableUs
International/Other Brands
Herclon (Roche)
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Perjeta-herceptinTrastuzumab (440 mg) + Pertuzumab (420 mg)Kit; Powder, for solution; SolutionIntravenousHoffmann La Roche2013-05-09Not applicableCanada
Categories
UNII
P188ANX8CK
CAS number
180288-69-1

Pharmacology

Indication

For treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2.

Structured Indications
Pharmacodynamics

Used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death.

Mechanism of action

Trastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells.

TargetActionsOrganism
AReceptor tyrosine-protein kinase erbB-2
antibody
Human
UEpidermal growth factor receptorNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
Absorption

Peak and trough plasma concentrations at steady state (between weeks 16 and 32) approximately 123 and 79 mcg/mL, respectively.

Volume of distribution
  • 44 mL/kg
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of elimination
Not Available
Half life

average 28.5 days. Pharmacokinetics are nonlinear; increased doses are associated with increased mean half-life and decreased clearance.

Clearance

Elimination may involve clearance of IgG through the reticuloendothelial system.

Toxicity

Administration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy.

Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Trastuzumab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Interacting Gene/EnzymeAllele nameGenotype(s)Defining Change(s)Type(s)DescriptionDetails
Receptor tyrosine-protein kinase erbB-2---(A;G)G Allele, heterozygoteADR Directly StudiedPatients with this genotype have increased risk of cardiotoxicity with trastuzumab.Details

Interactions

Drug Interactions
DrugInteractionDrug group
10-hydroxycamptothecinTrastuzumab may increase the cardiotoxic activities of 10-hydroxycamptothecin.Investigational
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideTrastuzumab may increase the cardiotoxic activities of 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.Experimental
2-chloroethyl-3-sarcosinamide-1-nitrosoureaTrastuzumab may increase the cardiotoxic activities of 2-chloroethyl-3-sarcosinamide-1-nitrosourea.Investigational
2-MethoxyestradiolTrastuzumab may increase the cardiotoxic activities of 2-Methoxyestradiol.Investigational
2-MethoxyethanolTrastuzumab may increase the neutropenic activities of 2-Methoxyethanol.Experimental
3-MethoxybenzamideTrastuzumab may increase the cardiotoxic activities of 3-Methoxybenzamide.Experimental
3,3'-diindolylmethaneTrastuzumab may increase the cardiotoxic activities of 3,3'-diindolylmethane.Investigational
3,4-Dihydroxybenzoic AcidTrastuzumab may increase the cardiotoxic activities of 3,4-Dihydroxybenzoic Acid.Experimental
6-O-benzylguanineTrastuzumab may increase the cardiotoxic activities of 6-O-benzylguanine.Investigational
7-HydroxystaurosporineTrastuzumab may increase the cardiotoxic activities of 7-Hydroxystaurosporine.Experimental
8-azaguanineTrastuzumab may increase the cardiotoxic activities of 8-azaguanine.Experimental
9-aminocamptothecinTrastuzumab may increase the cardiotoxic activities of 9-aminocamptothecin.Investigational
AbataceptTrastuzumab may increase the neutropenic activities of Abatacept.Approved
abetimusTrastuzumab may increase the neutropenic activities of abetimus.Investigational
AbirateroneTrastuzumab may increase the cardiotoxic activities of Abiraterone.Approved
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Trastuzumab.Approved
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Trastuzumab.Experimental
AclarubicinTrastuzumab may increase the cardiotoxic activities of Aclarubicin.Investigational
Acridine CarboxamideTrastuzumab may increase the cardiotoxic activities of Acridine Carboxamide.Investigational
ActeosideTrastuzumab may increase the cardiotoxic activities of Acteoside.Investigational
AdalimumabTrastuzumab may increase the neutropenic activities of Adalimumab.Approved
AdefovirTrastuzumab may increase the neutropenic activities of Adefovir.Investigational
AfatinibTrastuzumab may increase the cardiotoxic activities of Afatinib.Approved
AfelimomabTrastuzumab may increase the neutropenic activities of Afelimomab.Investigational
AfimoxifeneTrastuzumab may increase the cardiotoxic activities of Afimoxifene.Investigational
AlatrofloxacinTrastuzumab may increase the cardiotoxic activities of Alatrofloxacin.Withdrawn
AlbendazoleTrastuzumab may increase the cardiotoxic activities of Albendazole.Approved, Vet Approved
AldesleukinTrastuzumab may increase the cardiotoxic activities of Aldesleukin.Approved
AlefaceptTrastuzumab may increase the neutropenic activities of Alefacept.Approved, Withdrawn
AlemtuzumabTrastuzumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
AlicaforsenTrastuzumab may increase the neutropenic activities of Alicaforsen.Investigational
AlitretinoinTrastuzumab may increase the cardiotoxic activities of Alitretinoin.Approved, Investigational
AltretamineTrastuzumab may increase the cardiotoxic activities of Altretamine.Approved
AlvocidibTrastuzumab may increase the cardiotoxic activities of Alvocidib.Experimental, Investigational
AminoglutethimideTrastuzumab may increase the cardiotoxic activities of Aminoglutethimide.Approved
Aminolevulinic acidTrastuzumab may increase the cardiotoxic activities of Aminolevulinic acid.Approved
AmonafideTrastuzumab may increase the cardiotoxic activities of Amonafide.Investigational
AmrubicinTrastuzumab may increase the cardiotoxic activities of Amrubicin.Approved, Investigational
AmsacrineTrastuzumab may increase the cardiotoxic activities of Amsacrine.Approved
AnagrelideTrastuzumab may increase the cardiotoxic activities of Anagrelide.Approved
AnakinraTrastuzumab may increase the neutropenic activities of Anakinra.Approved
AnastrozoleTrastuzumab may increase the cardiotoxic activities of Anastrozole.Approved, Investigational
AnecortaveTrastuzumab may increase the cardiotoxic activities of Anecortave.Investigational
annamycinTrastuzumab may increase the cardiotoxic activities of annamycin.Investigational
Antilymphocyte immunoglobulin (horse)Trastuzumab may increase the neutropenic activities of Antilymphocyte immunoglobulin (horse).Approved
Antithymocyte immunoglobulin (rabbit)Trastuzumab may increase the neutropenic activities of Antithymocyte immunoglobulin (rabbit).Approved
AP 12009Trastuzumab may increase the cardiotoxic activities of AP 12009.Investigational
AP24534Trastuzumab may increase the cardiotoxic activities of AP24534.Investigational
ApaziquoneTrastuzumab may increase the cardiotoxic activities of Apaziquone.Investigational
ApremilastTrastuzumab may increase the neutropenic activities of Apremilast.Approved, Investigational
Arotinoid acidTrastuzumab may increase the cardiotoxic activities of TTNPB.Experimental
Arsanilic acidTrastuzumab may increase the cardiotoxic activities of Arsanilic acid.Experimental, Vet Approved
Arsenic trioxideTrastuzumab may increase the cardiotoxic activities of Arsenic trioxide.Approved, Investigational
AsparaginaseTrastuzumab may increase the cardiotoxic activities of Asparaginase.Approved
AxitinibTrastuzumab may increase the cardiotoxic activities of Axitinib.Approved, Investigational
AzacitidineTrastuzumab may increase the cardiotoxic activities of Azacitidine.Approved, Investigational
AzathioprineTrastuzumab may increase the cardiotoxic activities of Azathioprine.Approved
Azelaic AcidTrastuzumab may increase the cardiotoxic activities of Azelaic Acid.Approved
BasiliximabTrastuzumab may increase the neutropenic activities of Basiliximab.Approved, Investigational
BatimastatTrastuzumab may increase the cardiotoxic activities of Batimastat.Experimental
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Trastuzumab.Investigational
BegelomabTrastuzumab may increase the neutropenic activities of Begelomab.Experimental
BelataceptTrastuzumab may increase the neutropenic activities of Belatacept.Approved
BelimumabTrastuzumab may increase the neutropenic activities of Belimumab.Approved
BelinostatTrastuzumab may increase the cardiotoxic activities of Belinostat.Approved, Investigational
BelotecanTrastuzumab may increase the cardiotoxic activities of Belotecan.Investigational
BendamustineTrastuzumab may increase the cardiotoxic activities of Bendamustine.Approved, Investigational
BenznidazoleTrastuzumab may increase the neutropenic activities of Benznidazole.Approved
BesifloxacinTrastuzumab may increase the cardiotoxic activities of Besifloxacin.Approved
BetamethasoneTrastuzumab may increase the neutropenic activities of Betamethasone.Approved, Vet Approved
BevacizumabTrastuzumab may increase the cardiotoxic activities of Bevacizumab.Approved, Investigational
BexaroteneTrastuzumab may increase the cardiotoxic activities of Bexarotene.Approved, Investigational
BicalutamideTrastuzumab may increase the cardiotoxic activities of Bicalutamide.Approved
BinetrakinTrastuzumab may increase the cardiotoxic activities of Binetrakin.Investigational
BizelesinTrastuzumab may increase the cardiotoxic activities of Bizelesin.Investigational
BleomycinTrastuzumab may increase the cardiotoxic activities of Bleomycin.Approved
BlinatumomabTrastuzumab may increase the cardiotoxic activities of Blinatumomab.Approved
BortezomibTrastuzumab may increase the cardiotoxic activities of Bortezomib.Approved, Investigational
BosutinibTrastuzumab may increase the cardiotoxic activities of Bosutinib.Approved
Brentuximab vedotinTrastuzumab may increase the cardiotoxic activities of Brentuximab vedotin.Approved
BriakinumabTrastuzumab may increase the neutropenic activities of Briakinumab.Investigational
BrodalumabTrastuzumab may increase the neutropenic activities of Brodalumab.Approved, Investigational
BroxuridineTrastuzumab may increase the cardiotoxic activities of Broxuridine.Investigational
Bryostatin 1Trastuzumab may increase the cardiotoxic activities of Bryostatin 1.Investigational
BSI-201Trastuzumab may increase the cardiotoxic activities of BSI-201.Investigational
BudesonideTrastuzumab may increase the neutropenic activities of Budesonide.Approved
BusulfanTrastuzumab may increase the cardiotoxic activities of Busulfan.Approved, Investigational
Buthionine SulfoximineTrastuzumab may increase the cardiotoxic activities of Buthionine Sulfoximine.Investigational
CabazitaxelTrastuzumab may increase the cardiotoxic activities of Cabazitaxel.Approved
CabergolineTrastuzumab may increase the cardiotoxic activities of Cabergoline.Approved
CabozantinibTrastuzumab may increase the cardiotoxic activities of Cabozantinib.Approved
CalcipotriolTrastuzumab may increase the cardiotoxic activities of Calcipotriol.Approved
CamptothecinTrastuzumab may increase the cardiotoxic activities of Camptothecin.Experimental
CanakinumabTrastuzumab may increase the neutropenic activities of Canakinumab.Approved, Investigational
CanertinibTrastuzumab may increase the cardiotoxic activities of Canertinib.Investigational
CapecitabineTrastuzumab may increase the cardiotoxic activities of Capecitabine.Approved, Investigational
CarboplatinTrastuzumab may increase the cardiotoxic activities of Carboplatin.Approved
CarboquoneTrastuzumab may increase the cardiotoxic activities of Carboquone.Experimental
CarboxyamidotriazoleTrastuzumab may increase the cardiotoxic activities of Carboxyamidotriazole.Investigational
CarfilzomibTrastuzumab may increase the cardiotoxic activities of Carfilzomib.Approved
CarmofurTrastuzumab may increase the cardiotoxic activities of Carmofur.Withdrawn
CarmustineTrastuzumab may increase the cardiotoxic activities of Carmustine.Approved
CastanospermineTrastuzumab may increase the neutropenic activities of Castanospermine.Experimental
CatumaxomabTrastuzumab may increase the cardiotoxic activities of Catumaxomab.Investigational
CediranibTrastuzumab may increase the cardiotoxic activities of Cediranib.Investigational
CeritinibTrastuzumab may increase the cardiotoxic activities of Ceritinib.Approved
Certolizumab pegolTrastuzumab may increase the neutropenic activities of Certolizumab pegol.Approved
CetuximabTrastuzumab may increase the cardiotoxic activities of Cetuximab.Approved
ChlorambucilTrastuzumab may increase the cardiotoxic activities of Chlorambucil.Approved
ChlorotrianiseneTrastuzumab may increase the cardiotoxic activities of Chlorotrianisene.Withdrawn
CholesterolTrastuzumab may increase the cardiotoxic activities of Cholesterol.Experimental
CinoxacinTrastuzumab may increase the cardiotoxic activities of Cinoxacin.Approved, Withdrawn
CiprofloxacinTrastuzumab may increase the cardiotoxic activities of Ciprofloxacin.Approved, Investigational
CisplatinTrastuzumab may increase the cardiotoxic activities of Cisplatin.Approved
CladribineTrastuzumab may increase the cardiotoxic activities of Cladribine.Approved, Investigational
ClofarabineTrastuzumab may increase the cardiotoxic activities of Clofarabine.Approved, Investigational
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Trastuzumab.Approved
ColchicineTrastuzumab may increase the cardiotoxic activities of Colchicine.Approved
CombretastatinTrastuzumab may increase the cardiotoxic activities of Combretastatin.Investigational
CordycepinTrastuzumab may increase the cardiotoxic activities of Cordycepin.Investigational
CorticotropinTrastuzumab may increase the neutropenic activities of Corticotropin.Approved, Vet Approved
Cortisone acetateTrastuzumab may increase the neutropenic activities of Cortisone acetate.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Trastuzumab.Approved
Coumermycin A1Trastuzumab may increase the cardiotoxic activities of Coumermycin A1.Experimental
CrenolanibTrastuzumab may increase the cardiotoxic activities of Crenolanib.Investigational
CrizotinibTrastuzumab may increase the cardiotoxic activities of Crizotinib.Approved
CurcuminTrastuzumab may increase the cardiotoxic activities of Curcumin.Investigational
CyclophosphamideTrastuzumab may increase the cardiotoxic activities of Cyclophosphamide.Approved, Investigational
CyclosporineTrastuzumab may increase the neutropenic activities of Cyclosporine.Approved, Investigational, Vet Approved
CymarinCymarin may decrease the cardiotoxic activities of Trastuzumab.Experimental
Cyproterone acetateTrastuzumab may increase the cardiotoxic activities of Cyproterone acetate.Approved, Investigational
CytarabineTrastuzumab may increase the cardiotoxic activities of Cytarabine.Approved, Investigational
DabrafenibTrastuzumab may increase the cardiotoxic activities of Dabrafenib.Approved
DacarbazineTrastuzumab may increase the cardiotoxic activities of Dacarbazine.Approved, Investigational
DaclizumabTrastuzumab may increase the neutropenic activities of Daclizumab.Approved, Investigational
DactinomycinTrastuzumab may increase the cardiotoxic activities of Dactinomycin.Approved
DaratumumabTrastuzumab may increase the cardiotoxic activities of Daratumumab.Approved
DasatinibTrastuzumab may increase the cardiotoxic activities of Dasatinib.Approved, Investigational
DaunorubicinTrastuzumab may increase the cardiotoxic activities of Daunorubicin.Approved
DecitabineTrastuzumab may increase the cardiotoxic activities of Decitabine.Approved, Investigational
DeflazacortTrastuzumab may increase the neutropenic activities of Deflazacort.Approved
DemecolcineTrastuzumab may increase the cardiotoxic activities of Demecolcine.Experimental
Denileukin diftitoxTrastuzumab may increase the cardiotoxic activities of Denileukin diftitox.Approved, Investigational
DeoxyspergualinTrastuzumab may increase the cardiotoxic activities of Deoxyspergualin.Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Trastuzumab.Approved
DexamethasoneTrastuzumab may increase the cardiotoxic activities of Dexamethasone.Approved, Investigational, Vet Approved
DexrazoxaneTrastuzumab may increase the cardiotoxic activities of Dexrazoxane.Approved, Withdrawn
DianhydrogalactitolTrastuzumab may increase the cardiotoxic activities of Dianhydrogalactitol.Investigational
DidoxTrastuzumab may increase the cardiotoxic activities of Didox.Investigational
DienogestTrastuzumab may increase the cardiotoxic activities of Dienogest.Approved
diethylnorspermineTrastuzumab may increase the cardiotoxic activities of diethylnorspermine.Investigational
DiethylstilbestrolTrastuzumab may increase the cardiotoxic activities of Diethylstilbestrol.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Trastuzumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Trastuzumab.Approved
Dimethyl fumarateTrastuzumab may increase the neutropenic activities of Dimethyl fumarate.Approved, Investigational
DinutuximabTrastuzumab may increase the cardiotoxic activities of Dinutuximab.Approved
DocetaxelTrastuzumab may increase the cardiotoxic activities of Docetaxel.Approved, Investigational
Dolastatin 10Trastuzumab may increase the cardiotoxic activities of Dolastatin 10.Investigational
DoxifluridineTrastuzumab may increase the cardiotoxic activities of Doxifluridine.Investigational
DoxorubicinTrastuzumab may increase the cardiotoxic activities of Doxorubicin.Approved, Investigational
DuligotuzumabTrastuzumab may increase the cardiotoxic activities of Duligotuzumab.Investigational
EcabetTrastuzumab may increase the cardiotoxic activities of Ecabet.Approved, Investigational
EculizumabTrastuzumab may increase the neutropenic activities of Eculizumab.Approved, Investigational
EdrecolomabTrastuzumab may increase the cardiotoxic activities of Edrecolomab.Experimental
EfalizumabTrastuzumab may increase the neutropenic activities of Efalizumab.Approved, Investigational
EfaproxiralTrastuzumab may increase the cardiotoxic activities of Efaproxiral.Investigational
EfatutazoneTrastuzumab may increase the cardiotoxic activities of Efatutazone.Investigational
EflornithineTrastuzumab may increase the cardiotoxic activities of Eflornithine.Approved, Withdrawn
EG009Trastuzumab may increase the cardiotoxic activities of EG009.Investigational
ElsamitrucinTrastuzumab may increase the cardiotoxic activities of Elsamitrucin.Investigational
EndostatinTrastuzumab may increase the cardiotoxic activities of Endostatin.Investigational
EnoxacinTrastuzumab may increase the cardiotoxic activities of Enoxacin.Approved
EnrofloxacinTrastuzumab may increase the cardiotoxic activities of Enrofloxacin.Vet Approved
EntinostatTrastuzumab may increase the cardiotoxic activities of Entinostat.Investigational
Epigallocatechin GallateTrastuzumab may increase the cardiotoxic activities of Epigallocatechin Gallate.Investigational
EpirubicinTrastuzumab may increase the cardiotoxic activities of Epirubicin.Approved
EpofolateTrastuzumab may increase the cardiotoxic activities of Epofolate.Investigational
EribulinTrastuzumab may increase the cardiotoxic activities of Eribulin.Approved, Investigational
ErlotinibTrastuzumab may increase the cardiotoxic activities of Erlotinib.Approved, Investigational
EstramustineTrastuzumab may increase the cardiotoxic activities of Estramustine.Approved
EtanerceptTrastuzumab may increase the neutropenic activities of Etanercept.Approved, Investigational
EtanidazoleTrastuzumab may increase the cardiotoxic activities of Etanidazole.Investigational
Ethiodized oilTrastuzumab may increase the cardiotoxic activities of Ethiodized oil.Approved
Ethyl carbamateTrastuzumab may increase the cardiotoxic activities of Ethyl carbamate.Withdrawn
EtoglucidTrastuzumab may increase the cardiotoxic activities of Etoglucid.Experimental
EtoposideTrastuzumab may increase the cardiotoxic activities of Etoposide.Approved
EverolimusTrastuzumab may increase the cardiotoxic activities of Everolimus.Approved
ExatecanTrastuzumab may increase the cardiotoxic activities of Exatecan.Investigational
ExemestaneTrastuzumab may increase the cardiotoxic activities of Exemestane.Approved, Investigational
exisulindTrastuzumab may increase the cardiotoxic activities of exisulind.Investigational
FenretinideTrastuzumab may increase the cardiotoxic activities of Fenretinide.Investigational
FiacitabineTrastuzumab may increase the cardiotoxic activities of Fiacitabine.Investigational
FingolimodTrastuzumab may increase the neutropenic activities of Fingolimod.Approved, Investigational
FleroxacinTrastuzumab may increase the cardiotoxic activities of Fleroxacin.Approved
FloxuridineTrastuzumab may increase the cardiotoxic activities of Floxuridine.Approved
FludarabineTrastuzumab may increase the cardiotoxic activities of Fludarabine.Approved
FludrocortisoneTrastuzumab may increase the neutropenic activities of Fludrocortisone.Approved
FlumequineTrastuzumab may increase the cardiotoxic activities of Flumequine.Withdrawn
FluorouracilTrastuzumab may increase the cardiotoxic activities of Fluorouracil.Approved
FlutamideTrastuzumab may increase the cardiotoxic activities of Flutamide.Approved
FormestaneTrastuzumab may increase the cardiotoxic activities of Formestane.Approved, Investigational, Withdrawn
FormycinTrastuzumab may increase the cardiotoxic activities of Formycin.Experimental
FosbretabulinTrastuzumab may increase the cardiotoxic activities of Fosbretabulin.Investigational
FotemustineTrastuzumab may increase the cardiotoxic activities of Fotemustine.Experimental
FulvestrantTrastuzumab may increase the cardiotoxic activities of Fulvestrant.Approved, Investigational
FumagillinTrastuzumab may increase the cardiotoxic activities of Fumagillin.Experimental
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Trastuzumab.Investigational
Gallium nitrateTrastuzumab may increase the cardiotoxic activities of Gallium nitrate.Approved, Investigational
GarenoxacinTrastuzumab may increase the cardiotoxic activities of Garenoxacin.Investigational
GatifloxacinTrastuzumab may increase the cardiotoxic activities of Gatifloxacin.Approved, Investigational
GefitinibTrastuzumab may increase the cardiotoxic activities of Gefitinib.Approved, Investigational
GeldanamycinTrastuzumab may increase the cardiotoxic activities of Geldanamycin.Experimental
GemcitabineTrastuzumab may increase the cardiotoxic activities of Gemcitabine.Approved
GemifloxacinTrastuzumab may increase the cardiotoxic activities of Gemifloxacin.Approved, Investigational
Gemtuzumab ozogamicinTrastuzumab may increase the cardiotoxic activities of Gemtuzumab ozogamicin.Approved
GenisteinTrastuzumab may increase the cardiotoxic activities of Genistein.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Trastuzumab.Investigational
Ginsenoside CTrastuzumab may increase the cardiotoxic activities of Ginsenoside C.Nutraceutical
GitoformateGitoformate may decrease the cardiotoxic activities of Trastuzumab.Experimental
Glatiramer AcetateTrastuzumab may increase the neutropenic activities of Glatiramer Acetate.Approved, Investigational
GlimepirideTrastuzumab may increase the neutropenic activities of Glimepiride.Approved
GolimumabTrastuzumab may increase the neutropenic activities of Golimumab.Approved
GoserelinTrastuzumab may increase the cardiotoxic activities of Goserelin.Approved
GrepafloxacinTrastuzumab may increase the cardiotoxic activities of Grepafloxacin.Withdrawn
GS 0573Trastuzumab may increase the cardiotoxic activities of GS 0573.Investigational
GusperimusTrastuzumab may increase the cardiotoxic activities of Gusperimus.Investigational
HadacidinTrastuzumab may increase the cardiotoxic activities of Hadacidin.Experimental
HalofuginoneTrastuzumab may increase the cardiotoxic activities of Halofuginone.Investigational, Vet Approved
HexestrolTrastuzumab may increase the cardiotoxic activities of Hexestrol.Withdrawn
Human C1-esterase inhibitorTrastuzumab may increase the neutropenic activities of Human C1-esterase inhibitor.Approved
HydrocortisoneTrastuzumab may increase the neutropenic activities of Hydrocortisone.Approved, Vet Approved
Hydroxyprogesterone caproateTrastuzumab may increase the cardiotoxic activities of Hydroxyprogesterone caproate.Approved
HydroxyureaTrastuzumab may increase the cardiotoxic activities of Hydroxyurea.Approved
HypericinTrastuzumab may increase the cardiotoxic activities of Hypericin.Investigational
Ibritumomab tiuxetanTrastuzumab may increase the neutropenic activities of Ibritumomab tiuxetan.Approved
IbrutinibTrastuzumab may increase the cardiotoxic activities of Ibrutinib.Approved
IcatibantTrastuzumab may increase the neutropenic activities of Icatibant.Approved
IdarubicinTrastuzumab may increase the cardiotoxic activities of Idarubicin.Approved
IdelalisibTrastuzumab may increase the cardiotoxic activities of Idelalisib.Approved
IfosfamideTrastuzumab may increase the cardiotoxic activities of Ifosfamide.Approved
ImatinibTrastuzumab may increase the cardiotoxic activities of Imatinib.Approved
ImiquimodTrastuzumab may increase the cardiotoxic activities of Imiquimod.Approved, Investigational
IndirubinTrastuzumab may increase the cardiotoxic activities of Indirubin.Investigational
Indole-3-carbinolTrastuzumab may increase the cardiotoxic activities of Indole-3-carbinol.Investigational
InfigratinibTrastuzumab may increase the cardiotoxic activities of Infigratinib.Investigational
InfliximabTrastuzumab may increase the neutropenic activities of Infliximab.Approved
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Trastuzumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Trastuzumab.Investigational
IniparibTrastuzumab may increase the cardiotoxic activities of Iniparib.Experimental
Interferon beta-1aTrastuzumab may increase the cardiotoxic activities of Interferon beta-1a.Approved, Investigational
IobenguaneTrastuzumab may increase the cardiotoxic activities of Iobenguane.Approved
IpilimumabTrastuzumab may increase the cardiotoxic activities of Ipilimumab.Approved
IrinotecanTrastuzumab may increase the cardiotoxic activities of Irinotecan.Approved, Investigational
IrofulvenTrastuzumab may increase the cardiotoxic activities of Irofulven.Investigational
IrsogladineTrastuzumab may increase the cardiotoxic activities of Irsogladine.Investigational
IsosorbideTrastuzumab may increase the cardiotoxic activities of Isosorbide.Approved
IxabepiloneTrastuzumab may increase the cardiotoxic activities of Ixabepilone.Approved, Investigational
IxazomibTrastuzumab may increase the cardiotoxic activities of Ixazomib.Approved
KOS-1584Trastuzumab may increase the cardiotoxic activities of KOS-1584.Investigational
KRN-7000Trastuzumab may increase the cardiotoxic activities of KRN-7000.Investigational
L-alanosineTrastuzumab may increase the cardiotoxic activities of L-alanosine.Investigational
L-PhenylalanineTrastuzumab may increase the neutropenic activities of L-Phenylalanine.Approved, Nutraceutical
Lanatoside CLanatoside C may decrease the cardiotoxic activities of Trastuzumab.Experimental
LanreotideTrastuzumab may increase the cardiotoxic activities of Lanreotide.Approved
LapatinibTrastuzumab may increase the cardiotoxic activities of Lapatinib.Approved, Investigational
LCL-161Trastuzumab may increase the cardiotoxic activities of LCL-161.Investigational
LeflunomideTrastuzumab may increase the cardiotoxic activities of Leflunomide.Approved, Investigational
LenalidomideTrastuzumab may increase the cardiotoxic activities of Lenalidomide.Approved
LentinanTrastuzumab may increase the cardiotoxic activities of Lentinan.Experimental
LenvatinibTrastuzumab may increase the cardiotoxic activities of Lenvatinib.Approved
LetrozoleTrastuzumab may increase the cardiotoxic activities of Letrozole.Approved, Investigational
LeuprolideTrastuzumab may increase the cardiotoxic activities of Leuprolide.Approved, Investigational
LevofloxacinTrastuzumab may increase the cardiotoxic activities of Levofloxacin.Approved, Investigational
LiarozoleTrastuzumab may increase the cardiotoxic activities of Liarozole.Investigational
LisofyllineTrastuzumab may increase the neutropenic activities of Lisofylline.Investigational
LomefloxacinTrastuzumab may increase the cardiotoxic activities of Lomefloxacin.Approved
LometrexolTrastuzumab may increase the cardiotoxic activities of Lometrexol.Investigational
LomustineTrastuzumab may increase the cardiotoxic activities of Lomustine.Approved
LonidamineTrastuzumab may increase the cardiotoxic activities of Lonidamine.Approved, Investigational
LurtotecanTrastuzumab may increase the cardiotoxic activities of Lurtotecan.Investigational
LycopeneTrastuzumab may increase the cardiotoxic activities of Lycopene.Approved
MafosfamideTrastuzumab may increase the cardiotoxic activities of Mafosfamide.Investigational
MannosulfanTrastuzumab may increase the cardiotoxic activities of Mannosulfan.Experimental
MasitinibTrastuzumab may increase the cardiotoxic activities of Masitinib.Vet Approved
MasoprocolTrastuzumab may increase the cardiotoxic activities of Masoprocol.Approved
MaxacalcitolTrastuzumab may increase the cardiotoxic activities of Maxacalcitol.Approved
MebendazoleTrastuzumab may increase the cardiotoxic activities of Mebendazole.Approved, Vet Approved
MechlorethamineTrastuzumab may increase the cardiotoxic activities of Mechlorethamine.Approved
MedrogestoneTrastuzumab may increase the cardiotoxic activities of Medrogestone.Approved
Medroxyprogesterone acetateTrastuzumab may increase the cardiotoxic activities of Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateTrastuzumab may increase the cardiotoxic activities of Megestrol acetate.Approved, Vet Approved
MelphalanTrastuzumab may increase the cardiotoxic activities of Melphalan.Approved
MepolizumabTrastuzumab may increase the neutropenic activities of Mepolizumab.Approved, Investigational
MequinolTrastuzumab may increase the cardiotoxic activities of Mequinol.Approved
MercaptopurineTrastuzumab may increase the cardiotoxic activities of Mercaptopurine.Approved
MerestinibTrastuzumab may increase the cardiotoxic activities of Merestinib.Investigational
MethotrexateTrastuzumab may increase the cardiotoxic activities of Methotrexate.Approved
Methyl aminolevulinateTrastuzumab may increase the cardiotoxic activities of Methyl aminolevulinate.Approved
MethylprednisoloneTrastuzumab may increase the cardiotoxic activities of Methylprednisolone.Approved, Vet Approved
MethylselenocysteineTrastuzumab may increase the cardiotoxic activities of Methylselenocysteine.Investigational
MethyltestosteroneTrastuzumab may increase the cardiotoxic activities of Methyltestosterone.Approved
MetildigoxinMetildigoxin may decrease the cardiotoxic activities of Trastuzumab.Experimental
MetoprineTrastuzumab may increase the cardiotoxic activities of Metoprine.Experimental
MidostaurinTrastuzumab may increase the cardiotoxic activities of Midostaurin.Approved
MiltefosineTrastuzumab may increase the cardiotoxic activities of Miltefosine.Approved
MisonidazoleTrastuzumab may increase the cardiotoxic activities of Misonidazole.Investigational
MitobronitolTrastuzumab may increase the cardiotoxic activities of Mitobronitol.Experimental
MitoguazoneTrastuzumab may increase the cardiotoxic activities of Mitoguazone.Investigational
MitolactolTrastuzumab may increase the cardiotoxic activities of Mitolactol.Investigational
MitomycinTrastuzumab may increase the cardiotoxic activities of Mitomycin.Approved
MitotaneTrastuzumab may increase the cardiotoxic activities of Mitotane.Approved
MitoxantroneTrastuzumab may increase the cardiotoxic activities of Mitoxantrone.Approved, Investigational
MizoribineTrastuzumab may increase the cardiotoxic activities of Mizoribine.Investigational
MLN576Trastuzumab may increase the cardiotoxic activities of MLN576.Investigational
MolgramostimTrastuzumab may increase the cardiotoxic activities of Molgramostim.Investigational
motexafin gadoliniumTrastuzumab may increase the cardiotoxic activities of motexafin gadolinium.Investigational
MoxifloxacinTrastuzumab may increase the cardiotoxic activities of Moxifloxacin.Approved, Investigational
MuromonabTrastuzumab may increase the neutropenic activities of Muromonab.Approved, Investigational
Mycophenolate mofetilTrastuzumab may increase the neutropenic activities of Mycophenolate mofetil.Approved, Investigational
Mycophenolic acidTrastuzumab may increase the cardiotoxic activities of Mycophenolic acid.Approved
NadifloxacinTrastuzumab may increase the cardiotoxic activities of Nadifloxacin.Investigational
NafamostatTrastuzumab may increase the neutropenic activities of Nafamostat.Approved, Investigational
Nalidixic AcidTrastuzumab may increase the cardiotoxic activities of Nalidixic Acid.Approved
NamitecanTrastuzumab may increase the cardiotoxic activities of Namitecan.Investigational
NatalizumabTrastuzumab may increase the neutropenic activities of Natalizumab.Approved, Investigational
NavitoclaxTrastuzumab may increase the cardiotoxic activities of Navitoclax.Investigational
NebularineTrastuzumab may increase the cardiotoxic activities of Nebularine.Experimental
NecitumumabTrastuzumab may increase the cardiotoxic activities of Necitumumab.Approved
NedaplatinTrastuzumab may increase the cardiotoxic activities of Nedaplatin.Approved
NelarabineTrastuzumab may increase the cardiotoxic activities of Nelarabine.Approved, Investigational
NiguldipineTrastuzumab may increase the cardiotoxic activities of Niguldipine.Experimental
NilotinibTrastuzumab may increase the cardiotoxic activities of Nilotinib.Approved, Investigational
NilutamideTrastuzumab may increase the cardiotoxic activities of Nilutamide.Approved
NimustineTrastuzumab may increase the cardiotoxic activities of Nimustine.Investigational
NintedanibTrastuzumab may increase the cardiotoxic activities of Nintedanib.Approved
NiraparibTrastuzumab may increase the cardiotoxic activities of Niraparib.Approved, Investigational
NivolumabTrastuzumab may increase the cardiotoxic activities of Nivolumab.Approved
nocodazoleTrastuzumab may increase the cardiotoxic activities of nocodazole.Experimental
NolatrexedTrastuzumab may increase the cardiotoxic activities of Nolatrexed.Investigational
NorfloxacinTrastuzumab may increase the cardiotoxic activities of Norfloxacin.Approved
ObinutuzumabTrastuzumab may increase the cardiotoxic activities of Obinutuzumab.Approved
OblimersenTrastuzumab may increase the cardiotoxic activities of Oblimersen.Experimental
OBP-801Trastuzumab may increase the cardiotoxic activities of OBP-801.Investigational
OctreotideTrastuzumab may increase the cardiotoxic activities of Octreotide.Approved, Investigational
OfatumumabTrastuzumab may increase the cardiotoxic activities of Ofatumumab.Approved
OfloxacinTrastuzumab may increase the cardiotoxic activities of Ofloxacin.Approved
OglufanideTrastuzumab may increase the cardiotoxic activities of Oglufanide.Investigational
OlaparibTrastuzumab may increase the cardiotoxic activities of Olaparib.Approved
OleandrinOleandrin may decrease the cardiotoxic activities of Trastuzumab.Experimental
OltiprazTrastuzumab may increase the cardiotoxic activities of Oltipraz.Investigational
Omacetaxine mepesuccinateTrastuzumab may increase the cardiotoxic activities of Omacetaxine mepesuccinate.Approved
OnapristoneTrastuzumab may increase the cardiotoxic activities of Onapristone.Investigational
OprelvekinTrastuzumab may increase the cardiotoxic activities of Oprelvekin.Approved, Investigational
OsimertinibTrastuzumab may increase the cardiotoxic activities of Osimertinib.Approved
OuabainOuabain may decrease the cardiotoxic activities of Trastuzumab.Approved
OxaliplatinTrastuzumab may increase the cardiotoxic activities of Oxaliplatin.Approved, Investigational
Oxolinic acidTrastuzumab may increase the cardiotoxic activities of Oxolinic acid.Experimental
PaclitaxelTrastuzumab may increase the cardiotoxic activities of Paclitaxel.Approved, Vet Approved
PaclitaxelThe serum concentration of Paclitaxel can be decreased when it is combined with Trastuzumab.Approved, Vet Approved
Paclitaxel poliglumexTrastuzumab may increase the cardiotoxic activities of Paclitaxel poliglumex.Experimental
PalbociclibTrastuzumab may increase the cardiotoxic activities of Palbociclib.Approved
PalifosfamideTrastuzumab may increase the cardiotoxic activities of Palifosfamide.Investigational
PamidronateTrastuzumab may increase the cardiotoxic activities of Pamidronate.Approved
PanitumumabTrastuzumab may increase the cardiotoxic activities of Panitumumab.Approved, Investigational
PanobinostatTrastuzumab may increase the cardiotoxic activities of Panobinostat.Approved, Investigational
PaquinimodTrastuzumab may increase the neutropenic activities of Paquinimod.Investigational
PatupiloneTrastuzumab may increase the cardiotoxic activities of Patupilone.Experimental, Investigational
PazopanibTrastuzumab may increase the cardiotoxic activities of Pazopanib.Approved
PazufloxacinTrastuzumab may increase the cardiotoxic activities of Pazufloxacin.Investigational
PefloxacinTrastuzumab may increase the cardiotoxic activities of Pefloxacin.Approved
PegaspargaseTrastuzumab may increase the cardiotoxic activities of Pegaspargase.Approved, Investigational
PembrolizumabTrastuzumab may increase the cardiotoxic activities of Pembrolizumab.Approved
PemetrexedTrastuzumab may increase the cardiotoxic activities of Pemetrexed.Approved, Investigational
PenclomedineTrastuzumab may increase the cardiotoxic activities of Penclomedine.Investigational
PentostatinTrastuzumab may increase the cardiotoxic activities of Pentostatin.Approved, Investigational
PertuzumabTrastuzumab may increase the cardiotoxic activities of Pertuzumab.Approved
PeruvosidePeruvoside may decrease the cardiotoxic activities of Trastuzumab.Experimental
Phenethyl IsothiocyanateTrastuzumab may increase the cardiotoxic activities of Phenethyl Isothiocyanate.Investigational
Phenylacetic acidTrastuzumab may increase the cardiotoxic activities of Phenylacetic acid.Approved
Phenylbutyric acidTrastuzumab may increase the cardiotoxic activities of Phenylbutyric acid.Approved, Investigational
PimecrolimusTrastuzumab may increase the neutropenic activities of Pimecrolimus.Approved, Investigational
PinometostatTrastuzumab may increase the cardiotoxic activities of Pinometostat.Investigational
PipobromanTrastuzumab may increase the cardiotoxic activities of Pipobroman.Approved
PirarubicinTrastuzumab may increase the cardiotoxic activities of Pirarubicin.Investigational
PirfenidoneTrastuzumab may increase the cardiotoxic activities of Pirfenidone.Investigational
PirlindoleTrastuzumab may increase the cardiotoxic activities of Pirlindole.Approved
PixantroneTrastuzumab may increase the cardiotoxic activities of Pixantrone.Investigational
PlevitrexedTrastuzumab may increase the cardiotoxic activities of Plevitrexed.Investigational
PlicamycinTrastuzumab may increase the cardiotoxic activities of Plicamycin.Approved, Withdrawn
PodofiloxTrastuzumab may increase the cardiotoxic activities of Podofilox.Approved
PodophyllinTrastuzumab may increase the cardiotoxic activities of Podophyllin.Approved
PomalidomideTrastuzumab may increase the cardiotoxic activities of Pomalidomide.Approved
PonatinibTrastuzumab may increase the cardiotoxic activities of Ponatinib.Approved
Porfimer sodiumTrastuzumab may increase the cardiotoxic activities of Porfimer sodium.Approved, Investigational
porfiromycinTrastuzumab may increase the cardiotoxic activities of porfiromycin.Investigational
PralatrexateTrastuzumab may increase the cardiotoxic activities of Pralatrexate.Approved
PrednimustineTrastuzumab may increase the cardiotoxic activities of Prednimustine.Investigational
PrednisoloneTrastuzumab may increase the cardiotoxic activities of Prednisolone.Approved, Vet Approved
PrednisoneTrastuzumab may increase the cardiotoxic activities of Prednisone.Approved, Vet Approved
ProcarbazineTrastuzumab may increase the cardiotoxic activities of Procarbazine.Approved
ProscillaridinProscillaridin may decrease the cardiotoxic activities of Trastuzumab.Experimental
PrulifloxacinTrastuzumab may increase the cardiotoxic activities of Prulifloxacin.Investigational
PuromycinTrastuzumab may increase the cardiotoxic activities of Puromycin.Experimental
PyrazoloacridineTrastuzumab may increase the cardiotoxic activities of Pyrazoloacridine.Investigational
QuinacrineTrastuzumab may increase the cardiotoxic activities of Quinacrine.Approved
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Trastuzumab.Approved
RabusertibTrastuzumab may increase the cardiotoxic activities of Rabusertib.Investigational
Radium Ra 223 DichlorideTrastuzumab may increase the cardiotoxic activities of Radium Ra 223 Dichloride.Approved, Investigational
RaltitrexedTrastuzumab may increase the cardiotoxic activities of Raltitrexed.Approved, Investigational
RamucirumabTrastuzumab may increase the cardiotoxic activities of Ramucirumab.Approved, Investigational
RanibizumabTrastuzumab may increase the cardiotoxic activities of Ranibizumab.Approved
RanimustineTrastuzumab may increase the cardiotoxic activities of Ranimustine.Experimental
RanpirnaseTrastuzumab may increase the cardiotoxic activities of Ranpirnase.Investigational
RegorafenibTrastuzumab may increase the cardiotoxic activities of Regorafenib.Approved
ResveratrolTrastuzumab may increase the cardiotoxic activities of Resveratrol.Experimental, Investigational
Rhodamine 6GTrastuzumab may increase the cardiotoxic activities of Rhodamine 6G.Experimental
RidaforolimusTrastuzumab may increase the cardiotoxic activities of Ridaforolimus.Investigational
RilonaceptTrastuzumab may increase the neutropenic activities of Rilonacept.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Trastuzumab.Investigational
RituximabTrastuzumab may increase the cardiotoxic activities of Rituximab.Approved
RomidepsinTrastuzumab may increase the cardiotoxic activities of Romidepsin.Approved, Investigational
RoquinimexTrastuzumab may increase the cardiotoxic activities of Roquinimex.Investigational
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Trastuzumab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Trastuzumab.Approved
RubitecanTrastuzumab may increase the cardiotoxic activities of Rubitecan.Investigational
RucaparibTrastuzumab may increase the cardiotoxic activities of Rucaparib.Approved, Investigational
RufloxacinTrastuzumab may increase the cardiotoxic activities of Rufloxacin.Experimental
RuxolitinibTrastuzumab may increase the cardiotoxic activities of Ruxolitinib.Approved
SalirasibTrastuzumab may increase the cardiotoxic activities of Salirasib.Investigational
SaracatinibTrastuzumab may increase the cardiotoxic activities of Saracatinib.Investigational
SatraplatinTrastuzumab may increase the cardiotoxic activities of Satraplatin.Investigational
SecukinumabTrastuzumab may increase the neutropenic activities of Secukinumab.Approved
SeliciclibTrastuzumab may increase the cardiotoxic activities of Seliciclib.Investigational
SemapimodTrastuzumab may increase the neutropenic activities of Semapimod.Investigational
SemaxanibTrastuzumab may increase the cardiotoxic activities of Semaxanib.Investigational
SemustineTrastuzumab may increase the cardiotoxic activities of Semustine.Experimental
SeocalcitolTrastuzumab may increase the cardiotoxic activities of Seocalcitol.Experimental
SiltuximabTrastuzumab may increase the cardiotoxic activities of Siltuximab.Approved
SirolimusTrastuzumab may increase the cardiotoxic activities of Sirolimus.Approved, Investigational
SitafloxacinTrastuzumab may increase the cardiotoxic activities of Sitafloxacin.Experimental
SizofiranTrastuzumab may increase the cardiotoxic activities of Sizofiran.Investigational
SoblidotinTrastuzumab may increase the cardiotoxic activities of Soblidotin.Investigational
SonidegibTrastuzumab may increase the cardiotoxic activities of Sonidegib.Approved, Investigational
SorafenibTrastuzumab may increase the cardiotoxic activities of Sorafenib.Approved, Investigational
SparfloxacinTrastuzumab may increase the cardiotoxic activities of Sparfloxacin.Approved
Sparfosic acidTrastuzumab may increase the cardiotoxic activities of Sparfosic acid.Experimental
SparsomycinTrastuzumab may increase the cardiotoxic activities of Sparsomycin.Experimental
squalamineTrastuzumab may increase the cardiotoxic activities of squalamine.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Trastuzumab.Investigational
SRT501Trastuzumab may increase the cardiotoxic activities of SRT501.Investigational
SteproninTrastuzumab may increase the neutropenic activities of Stepronin.Approved
StreptozocinTrastuzumab may increase the cardiotoxic activities of Streptozocin.Approved
SulforaphaneTrastuzumab may increase the cardiotoxic activities of Sulforaphane.Investigational
SulindacTrastuzumab may increase the cardiotoxic activities of Sulindac.Approved
SunitinibTrastuzumab may increase the cardiotoxic activities of Sunitinib.Approved, Investigational
SuraminTrastuzumab may increase the cardiotoxic activities of Suramin.Approved
TacrolimusTrastuzumab may increase the neutropenic activities of Tacrolimus.Approved, Investigational
TalaporfinTrastuzumab may increase the cardiotoxic activities of Talaporfin.Investigational
TalazoparibTrastuzumab may increase the cardiotoxic activities of Talazoparib.Investigational
TamoxifenTrastuzumab may increase the cardiotoxic activities of Tamoxifen.Approved
TaselisibTrastuzumab may increase the cardiotoxic activities of Taselisib.Investigational
TaurolidineTrastuzumab may increase the cardiotoxic activities of Taurolidine.Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Trastuzumab.Investigational
TegafurTrastuzumab may increase the cardiotoxic activities of Tegafur.Approved
TemafloxacinTrastuzumab may increase the cardiotoxic activities of Temafloxacin.Withdrawn
TemoporfinTrastuzumab may increase the cardiotoxic activities of Temoporfin.Approved
TemozolomideTrastuzumab may increase the cardiotoxic activities of Temozolomide.Approved, Investigational
TemsirolimusTrastuzumab may increase the cardiotoxic activities of Temsirolimus.Approved
TeniposideTrastuzumab may increase the cardiotoxic activities of Teniposide.Approved
TepoxalinTrastuzumab may increase the neutropenic activities of Tepoxalin.Vet Approved
TeriflunomideTrastuzumab may increase the neutropenic activities of Teriflunomide.Approved
TestolactoneTrastuzumab may increase the cardiotoxic activities of Testolactone.Approved
TezacitabineTrastuzumab may increase the cardiotoxic activities of Tezacitabine.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Trastuzumab.Investigational
ThalidomideTrastuzumab may increase the cardiotoxic activities of Thalidomide.Approved, Investigational, Withdrawn
ThiotepaTrastuzumab may increase the cardiotoxic activities of Thiotepa.Approved
ThymalfasinTrastuzumab may increase the cardiotoxic activities of Thymalfasin.Approved, Investigational
TiazofurineTrastuzumab may increase the cardiotoxic activities of Tiazofurine.Experimental
TiboloneTrastuzumab may increase the cardiotoxic activities of Tibolone.Approved
TioguanineTrastuzumab may increase the cardiotoxic activities of Tioguanine.Approved
Tiomolibdate ionTrastuzumab may increase the cardiotoxic activities of Tiomolibdate ion.Investigational
TipifarnibTrastuzumab may increase the cardiotoxic activities of Tipifarnib.Investigational
TirapazamineTrastuzumab may increase the cardiotoxic activities of Tirapazamine.Investigational
TivozanibTrastuzumab may increase the cardiotoxic activities of Tivozanib.Investigational
TocilizumabTrastuzumab may increase the neutropenic activities of Tocilizumab.Approved
TofacitinibTrastuzumab may increase the neutropenic activities of Tofacitinib.Approved, Investigational
TopotecanTrastuzumab may increase the cardiotoxic activities of Topotecan.Approved, Investigational
ToremifeneTrastuzumab may increase the cardiotoxic activities of Toremifene.Approved, Investigational
TositumomabTrastuzumab may increase the cardiotoxic activities of Tositumomab.Approved
TositumomabTrastuzumab may increase the neutropenic activities of Tositumomab.Approved
TrabectedinTrastuzumab may increase the cardiotoxic activities of Trabectedin.Approved, Investigational
TrametinibTrastuzumab may increase the cardiotoxic activities of Trametinib.Approved
Trastuzumab emtansineTrastuzumab may increase the cardiotoxic activities of Trastuzumab emtansine.Approved
TrebananibTrastuzumab may increase the cardiotoxic activities of Trebananib.Investigational
TremelimumabTrastuzumab may increase the cardiotoxic activities of Tremelimumab.Investigational
TreosulfanTrastuzumab may increase the cardiotoxic activities of Treosulfan.Investigational
TretazicarTrastuzumab may increase the cardiotoxic activities of Tretazicar.Investigational
TretinoinTrastuzumab may increase the cardiotoxic activities of Tretinoin.Approved, Investigational, Nutraceutical
TriamcinoloneTrastuzumab may increase the neutropenic activities of Triamcinolone.Approved, Vet Approved
TriaziquoneTrastuzumab may increase the cardiotoxic activities of Triaziquone.Experimental
TrilostaneTrastuzumab may increase the cardiotoxic activities of Trilostane.Approved, Investigational, Vet Approved, Withdrawn
TrimetrexateTrastuzumab may increase the cardiotoxic activities of Trimetrexate.Approved, Investigational
TriptolideTrastuzumab may increase the cardiotoxic activities of Triptolide.Investigational
TriptorelinTrastuzumab may increase the cardiotoxic activities of Triptorelin.Approved, Vet Approved
TrofosfamideTrastuzumab may increase the cardiotoxic activities of Trofosfamide.Investigational
TrovafloxacinTrastuzumab may increase the cardiotoxic activities of Trovafloxacin.Approved, Withdrawn
TroxacitabineTrastuzumab may increase the cardiotoxic activities of Troxacitabine.Investigational
TubercidinTrastuzumab may increase the cardiotoxic activities of Tubercidin.Experimental
UbenimexTrastuzumab may increase the cardiotoxic activities of Ubenimex.Experimental
Uracil mustardTrastuzumab may increase the cardiotoxic activities of Uracil mustard.Approved
UstekinumabTrastuzumab may increase the neutropenic activities of Ustekinumab.Approved, Investigational
VadimezanTrastuzumab may increase the cardiotoxic activities of Vadimezan.Investigational
ValrubicinTrastuzumab may increase the cardiotoxic activities of Valrubicin.Approved
VandetanibTrastuzumab may increase the cardiotoxic activities of Vandetanib.Approved
VapreotideTrastuzumab may increase the cardiotoxic activities of Vapreotide.Approved, Investigational
VedolizumabTrastuzumab may increase the neutropenic activities of Vedolizumab.Approved
VeliparibTrastuzumab may increase the cardiotoxic activities of Veliparib.Investigational
VemurafenibTrastuzumab may increase the cardiotoxic activities of Vemurafenib.Approved
VerteporfinTrastuzumab may increase the cardiotoxic activities of Verteporfin.Approved, Investigational
VesnarinoneTrastuzumab may increase the cardiotoxic activities of Vesnarinone.Investigational
VilanterolTrastuzumab may increase the neutropenic activities of Vilanterol.Approved
VinblastineTrastuzumab may increase the cardiotoxic activities of Vinblastine.Approved
VincristineTrastuzumab may increase the cardiotoxic activities of Vincristine.Approved, Investigational
VindesineTrastuzumab may increase the cardiotoxic activities of Vindesine.Approved
VinflunineTrastuzumab may increase the cardiotoxic activities of Vinflunine.Approved
VinorelbineTrastuzumab may increase the cardiotoxic activities of Vinorelbine.Approved, Investigational
VintafolideTrastuzumab may increase the cardiotoxic activities of Vintafolide.Investigational
VismodegibTrastuzumab may increase the cardiotoxic activities of Vismodegib.Approved
Vitamin ATrastuzumab may increase the cardiotoxic activities of Vitamin A.Approved, Nutraceutical, Vet Approved
VoclosporinTrastuzumab may increase the neutropenic activities of Voclosporin.Investigational
VorinostatTrastuzumab may increase the cardiotoxic activities of Vorinostat.Approved, Investigational
VorozoleTrastuzumab may increase the cardiotoxic activities of Vorozole.Experimental
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Trastuzumab.Approved
ZorubicinTrastuzumab may increase the cardiotoxic activities of Zorubicin.Experimental
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Trastuzumab.Approved
Zuretinol acetateTrastuzumab may increase the cardiotoxic activities of Zuretinol acetate.Investigational
Food Interactions
Not Available

References

General References
  1. Bange J, Zwick E, Ullrich A: Molecular targets for breast cancer therapy and prevention. Nat Med. 2001 May;7(5):548-52. [PubMed:11329054]
  2. Menard S, Pupa SM, Campiglio M, Tagliabue E: Biologic and therapeutic role of HER2 in cancer. Oncogene. 2003 Sep 29;22(42):6570-8. [PubMed:14528282]
  3. Kute T, Lack CM, Willingham M, Bishwokama B, Williams H, Barrett K, Mitchell T, Vaughn JP: Development of Herceptin resistance in breast cancer cells. Cytometry A. 2004 Feb;57(2):86-93. [PubMed:14750129]
  4. Albanell J, Codony J, Rovira A, Mellado B, Gascon P: Mechanism of action of anti-HER2 monoclonal antibodies: scientific update on trastuzumab and 2C4. Adv Exp Med Biol. 2003;532:253-68. [PubMed:12908564]
  5. Tan AR, Swain SM: Ongoing adjuvant trials with trastuzumab in breast cancer. Semin Oncol. 2003 Oct;30(5 Suppl 16):54-64. [PubMed:14613027]
  6. Nebija D, Kopelent-Frank H, Urban E, Noe CR, Lachmann B: Comparison of two-dimensional gel electrophoresis patterns and MALDI-TOF MS analysis of therapeutic recombinant monoclonal antibodies trastuzumab and rituximab. J Pharm Biomed Anal. 2011 Dec 5;56(4):684-91. doi: 10.1016/j.jpba.2011.07.006. Epub 2011 Jul 18. [PubMed:21813259]
External Links
UniProt
P01857
Genbank
J00228
KEGG Drug
D03257
ChEMBL
CHEMBL1201585
Therapeutic Targets Database
DAP000391
PharmGKB
PA451743
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Trastuzumab
ATC Codes
L01XC03 — Trastuzumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (41 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingDiagnosticNeoplasms, Breast1
0CompletedTreatmentCancer, Breast1
0WithdrawnTreatmentAdvanced Solid Tumors / Documented Her2 Overexpression / Metastatic Brain Tumors / Neurologically Stable1
1Active Not RecruitingOtherMetastatic Breast Cancer (MBC)1
1Active Not RecruitingTreatmentAdvanced HER2-positive Breast Cancer / Brain Metastases From HER2 and Breast Cancer1
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentCancer, Breast2
1Active Not RecruitingTreatmentHER2 Positive Metastatic Breast Cancers1
1Active Not RecruitingTreatmentHER2/Neu Positive / Invasive Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
1Active Not RecruitingTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
1Active Not RecruitingTreatmentNeoplasms, Breast2
1CompletedNot AvailableHealthy Volunteers4
1CompletedBasic ScienceHealthy Volunteers1
1CompletedTreatmentAbdominal wall neoplasm / Neoplasms, Breast / Neoplasms, Ovarian / Neoplasms, Pancreatic / Stomach Neoplasms1
1CompletedTreatmentAdvanced Adult Primary Liver Cancer / Anaplastic Thyroid Cancers / Bone Metastases / Carcinoma of the Appendix / Distal Urethral Cancer / Fallopian Tube Cancer / Gastrinoma / Glucagonoma / Hepatic Metastases / Inflammatory carcinoma of the breast / Insulinoma / Localized Unresectable Adult Primary Liver Cancer / Lung Cancer Metastatic / Male Breast Cancer / Malignant Pericardial Effusion / Malignant Pleural Effusions / Metastases to skin / Metastatic Gastrointestinal Carcinoid Tumor / Metastatic Parathyroid Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Newly Diagnosed Carcinoma of Unknown Primary / Occult Non-small Cell Lung Cancer / Pancreatic Polypeptide Tumor / Primary Peritoneal Cavity Cancer / Proximal Urethral Cancer / Pulmonary Carcinoid Tumor / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Adrenocortical Carcinoma / Recurrent Adult Primary Liver Cancer / Recurrent Anal Cancer / Recurrent Bladder Cancer / Recurrent Breast Cancer / Recurrent Carcinoma of Unknown Primary / Recurrent Cervical Cancer / Recurrent Colon Cancer / Recurrent Endometrial Carcinoma / Recurrent Esophageal Cancer / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Recurrent Gastric Cancer / Recurrent Gastrointestinal Carcinoid Tumor / Recurrent Islet Cell Carcinoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Non-small Cell Lung Cancer / Recurrent Ovarian Epithelial Cancer / Recurrent Pancreatic Cancer / Recurrent Parathyroid Cancer / Recurrent Prostate Cancer / Recurrent Rectal Cancer / Recurrent Renal Cell Cancer / Recurrent Salivary Gland Cancer / Recurrent Small Intestine Cancer / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Thyroid Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Recurrent Vaginal Cancer / Recurrent Vulvar Cancer / Small Intestine Adenocarcinoma / Somatostatinoma / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Adrenocortical Carcinoma / Stage III Bladder Cancer / Stage III Cervical Cancer / Stage III Colon Cancer / Stage III Endometrial Carcinoma / Stage III Esophageal Cancer / Stage III Follicular Thyroid Cancer / Stage III Gastric Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Ovarian Epithelial Cancer / Stage III Pancreatic Cancer / Stage III Papillary Thyroid Cancer / Stage III Prostate Cancer / Stage III Rectal Cancer / Stage III Renal Cell Cancer / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Vaginal Cancer / Stage III Vulvar Cancer / Stage IIIA Anal Cancer / Stage IIIA Breast Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Anal Cancer / Stage IIIB Breast Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Adrenocortical Carcinoma / Stage IV Anal Cancer / Stage IV Bladder Cancer / Stage IV Breast Cancer / Stage IV Colon Cancer / Stage IV Endometrial Carcinoma / Stage IV Esophageal Cancer / Stage IV Follicular Thyroid Cancer / Stage IV Gastric Cancer / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Ovarian Epithelial Cancer / Stage IV Pancreatic Cancer / Stage IV Papillary Thyroid Cancer / Stage IV Prostate Cancer / Stage IV Rectal Cancer / Stage IV Renal Cell Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IVA Cervical Cancer / Stage IVA Vaginal Cancer / Stage IVB Cervical Cancer / Stage IVB Vaginal Cancer / Stage IVB Vulvar Cancer / Thyroid Gland Medullary Carcinoma / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer / Urethral Cancer Associated With Invasive Bladder Cancer / WDHA Syndrome1
1CompletedTreatmentAdvanced Cancers1
1CompletedTreatmentAdvanced HER2-positive Breast Cancer or Gastric Cancer1
1CompletedTreatmentAdvanced Solid Malignancies / Malignancies, Hematologic1
1CompletedTreatmentAdvanced Solid Tumors / Cancer, Breast1
1CompletedTreatmentAdvanced Solid Tumors / Cancers / Tumors1
1CompletedTreatmentBreast Cancer Metastatic1
1CompletedTreatmentBreastcancer1
1CompletedTreatmentCancer, Breast8
1CompletedTreatmentCancer, Breast / Cancers / Locally Recurrent and Metastatic Breast Cancer / Metastases / Metastatic Cancers / Neoplasms, Breast / Oncology / Tumors / Tumors, Breast / Tumors, Solid1
1CompletedTreatmentCancer, Breast / Metastatic Brain Tumors1
1CompletedTreatmentCancer, Breast / Metastatic Breast Cancer, Locally Advanced Breast Cancer1
1CompletedTreatmentCancer, Breast / Metastatic Cancers1
1CompletedTreatmentCancer, Breast / Tumors, Solid1
1CompletedTreatmentCancers1
1CompletedTreatmentHER-2 Gene Amplification1
1CompletedTreatmentHER-2 Positive Breast Cancer / Metastatic Breast Cancer (MBC)1
1CompletedTreatmentHealthy Volunteers1
1CompletedTreatmentLocally Advanced Breast Cancer (LABC) / Metastatic Breast Cancer (MBC)1
1CompletedTreatmentMale Breast Cancer / Recurrent Breast Cancer / Recurrent Endometrial Carcinoma / Recurrent Gastric Cancer / Recurrent Non-small Cell Lung Cancer / Recurrent Ovarian Epithelial Cancer / Recurrent Small Cell Lung Cancer1
1CompletedTreatmentMetastatic Breast Cancer (MBC)2
1CompletedTreatmentMetastatic or Locally Advanced Solid Tumors1
1CompletedTreatmentNeoplasms, Breast3
1CompletedTreatmentNeoplasms, Breast / Stomach Neoplasms1
1CompletedTreatmentSolid Cancers1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific3
1RecruitingTreatmentAsymptomatic or Low Symptomatic Brain Metastasis in Breast Cancer / HER2 Positive Untreated Metastatic Breast Cancer1
1RecruitingTreatmentCancer, Advanced / Metastatic Cancers / NonHodgkin Lymphoma / Tumors, Solid1
1RecruitingTreatmentCancer, Breast4
1RecruitingTreatmentCancer, Breast / Tumors, Solid1
1RecruitingTreatmentHER2 Positive Breast Cancers1
1RecruitingTreatmentHER2 Positive Breast Cancers / Her2-negative Metastatic Breast Cancer / HER2-positive Metastatic Breast Cancer / Locally Advanced or Early Breast Cancer1
1RecruitingTreatmentHealthy Volunteers / Neoplasms, Breast1
1RecruitingTreatmentInflammatory carcinoma of the breast1
1RecruitingTreatmentMetastatic Breast Cancer (MBC) / Recurrent Breast Cancer1
1RecruitingTreatmentNeoplasms, Breast1
1RecruitingTreatmentStage I Breast Carcinoma1
1RecruitingTreatmentTumors, Solid1
1TerminatedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Her2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Recurrent Esophageal Cancer / Recurrent Gastric Cancer / Stage IIIC Breast Cancer / Stage IIIC Esophageal Cancer / Stage IIIC Gastric Cancer / Stage IV Breast Cancer / Stage IV Esophageal Cancer / Stage IV Gastric Cancer1
1TerminatedTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
1TerminatedTreatmentNeoplasms1
1Unknown StatusTreatmentMetastatic Breast Cancer (MBC)1
1WithdrawnTreatmentCancer, Breast1
1, 2Active Not RecruitingTreatmentAdvanced Breast Cancer1
1, 2Active Not RecruitingTreatmentCancer, Breast2
1, 2Active Not RecruitingTreatmentCancer, Breast / DCIS Breast Cancer1
1, 2Active Not RecruitingTreatmentHER2/Neu Positive / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
1, 2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)2
1, 2CompletedTreatmentBladder Urothelial Carcinoma / Stage I Bladder Cancer / Stage II Bladder Cancer / Stage III Bladder Cancer1
1, 2CompletedTreatmentCancer, Breast12
1, 2CompletedTreatmentCancer, Breast / Lung Cancers / Malignant Gliomas / Melanoma / Metastatic Brain Tumors1
1, 2CompletedTreatmentCancer, Breast / Male Breast Cancer / Recurrent Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentCancer, Breast / Neoplasms Metastasis1
1, 2CompletedTreatmentCancer, Breast / Neoplasms, Breast1
1, 2CompletedTreatmentHER-2 Positive Advanced Gastric Cancer1
1, 2CompletedTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentMetastatic Breast Carcinoma1
1, 2CompletedTreatmentOesophageal Carcinoma1
1, 2Not Yet RecruitingTreatmentBreast Cancer, Male / Cancer, Breast / Her2-Positive Breast Cancer / Malignant Neoplasm of Female Breast1
1, 2Not Yet RecruitingTreatmentBreast Diseases / Neoplasms, Breast1
1, 2Not Yet RecruitingTreatmentMalignant Neoplasm of Breast1
1, 2Not Yet RecruitingTreatmentMalignant Neoplasm of Stomach1
1, 2RecruitingTreatmentCancer, Advanced / Cancer, Breast / Colorectal Cancers / Esophageal Cancers / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentCancer, Breast1
1, 2RecruitingTreatmentCancer, Breast / Cholangiocarcinomas / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Solid Tumours / MPN / Multiple Myeloma (MM) / Neoplasms, Endometrial / Stomach Neoplasms / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentCancer, Breast / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentCarcinoma, Breast / HER-2 Positive Breast Cancer / Metastatic Breast Cancer (MBC)1
1, 2RecruitingTreatmentCarcinomatous Meningitis / Metastatic Breast Cancer (MBC)1
1, 2RecruitingTreatmentMalignant Neoplasm of Stomach1
1, 2RecruitingTreatmentRecurrent Breast Cancer1
1, 2TerminatedTreatmentCancer, Breast5
1, 2TerminatedTreatmentHER-2 Positive Breast Cancer1
1, 2TerminatedTreatmentHER-2 Positive Breast Cancer / Metastatic Malignant Neoplasm to Brain1
1, 2TerminatedTreatmentHER2 + Breast Cancer / Metastatic Breast Cancer (MBC)1
1, 2TerminatedTreatmentMetastatic Breast Cancer (MBC)1
1, 2TerminatedTreatmentNeoplasms1
1, 2TerminatedTreatmentStage IV (Metastatic) Breast Cancer1
1, 2Unknown StatusTreatmentCancer, Breast1
1, 2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
1, 2WithdrawnTreatmentBrain and Central Nervous System Tumors / Cancer, Breast / Cognitive/Functional Effects / Drug/Agent Toxicity by Tissue/Organ / Psychosocial Effects of Cancer and Its Treatment1
1, 2WithdrawnTreatmentCancer, Breast1
2Active Not RecruitingNot AvailableAdenocarcinoma of the Gastro-oesophageal Junction / Metastatic Gastric Cancers1
2Active Not RecruitingNot AvailableNeoplasms, Breast1
2Active Not RecruitingBasic ScienceStage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingOtherCancer, Breast / Locally Advanced Malignant Neoplasm1
2Active Not RecruitingTreatmentAdvanced Breast Cancer / Cancer, Breast1
2Active Not RecruitingTreatmentAdvanced Breast Cancer / HER2 Amplified / Human Epidermal Growth Factor Receptor 2 (HER2)1
2Active Not RecruitingTreatmentCancer, Breast22
2Active Not RecruitingTreatmentCancer, Breast / Carcinoma of the Breast1
2Active Not RecruitingTreatmentCancer, Breast / Circulating Tumor Cells / Human Epidermal Growth Factor 2 Negative Carcinoma of Breast1
2Active Not RecruitingTreatmentCancer, Breast / HER2-Negative Breast Cancer / Her2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingTreatmentCancer, Breast / Metastatic Brain Tumors / Metastatic Breast Cancer (MBC) / Triple Negative Breast Cancer (TNBC)1
2Active Not RecruitingTreatmentElderly Metastatic Breast Cancer Population1
2Active Not RecruitingTreatmentEndometrial Cancers1
2Active Not RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2Active Not RecruitingTreatmentGeriatric Health Services / HER2/Neu Positive / Neoplasms, Breast1
2Active Not RecruitingTreatmentHER-2 Positive Breast Cancer3
2Active Not RecruitingTreatmentHER2-Positive Early Stage Breast Cancer1
2Active Not RecruitingTreatmentHer-2 Positive Gastric Cancer / Metastatic or Recurrent Gastric Adenocarcinoma1
2Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
2Active Not RecruitingTreatmentMalignant Tumor of the Breast / Neoplasms, Breast1
2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)4
2Active Not RecruitingTreatmentMetastatic Cancers1
2Active Not RecruitingTreatmentMetastatic HER2-Positive Breast Cancer1
2Active Not RecruitingTreatmentNeoplasms, Breast2
2CompletedTreatmentAdenocarcinoma of the Extrahepatic Bile Duct / Adenocarcinoma of the Gallbladder / Neoplasms, Malignant / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer1
2CompletedTreatmentAdvanced Breast Cancer / Cancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentAdvanced HER2-positive Breast Cancer1
2CompletedTreatmentBreast Cancer Metastatic1
2CompletedTreatmentCancer of the Breast / Cancer, Breast / Neoplasms, Breast1
2CompletedTreatmentCancer, Breast58
2CompletedTreatmentCancer, Breast / Cardiac Toxicity1
2CompletedTreatmentCancer, Breast / HER2 Positive1
2CompletedTreatmentCancer, Breast / Metastatic Brain Tumors1
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentCancer, Breast / Neoplasms, Breast2
2CompletedTreatmentCarcinoma, Breast1
2CompletedTreatmentColorectal Cancers1
2CompletedTreatmentERBB2 Gene Amplification / Neoplasms Metastasis / Stomach Neoplasms1
2CompletedTreatmentEndometrial Adenocarcinomas / Recurrent Endometrial Carcinoma / Stage III Endometrial Carcinoma / Stage IV Endometrial Carcinoma1
2CompletedTreatmentEstrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / Her2-Positive Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentEstrogen Receptor-Positive Breast Cancer / Her2-Positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2CompletedTreatmentHER-2 Positive Metastatic Breast Cancer1
2CompletedTreatmentHER2-positive, Newly Diagnosed, Primary Breast Cancer, Neoadjuvant Therapy, Trastuzumab1
2CompletedTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer2
2CompletedTreatmentHer2-Positive Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentInflammatory carcinoma of the breast / Locally Advanced Breast Cancer (LABC)1
2CompletedTreatmentLung Cancers2
2CompletedTreatmentMale Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentMalignant Neoplasm of Pancreas / Neoplasms, Pancreatic1
2CompletedTreatmentMalignant Neoplasm of Stomach2
2CompletedTreatmentMetastatic Breast Cancer (MBC)5
2CompletedTreatmentMetastatic Osteosarcoma1
2CompletedTreatmentMetastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Squamous Cell Carcinoma of the Bladder / Stage IV Bladder Cancer / Transitional Cell Carcinoma of the Bladder1
2CompletedTreatmentNeoplasms, Breast13
2CompletedTreatmentProstate Cancer2
2CompletedTreatmentRecurrent Bladder Cancer / Stage IV Bladder Cancer / Transitional Cell Carcinoma of the Bladder1
2CompletedTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentRecurrent Non-small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentSarcomas2
2CompletedTreatmentStage IV Gastric Cancer With Metastasis1
2CompletedTreatmentUnilateral HER2 Positive Breast Cancer1
2CompletedTreatmentUrinary Tract Cancers1
2CompletedTreatmentUrologic Neoplasms1
2Not Yet RecruitingTreatmentBreast Cancer Stage II / Breast Cancer Stage III / Cancer, Breast1
2RecruitingBasic ScienceCancer, Breast1
2RecruitingPreventionCancer, Breast2
2RecruitingTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Carcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / HER-2 Gene Amplification / Metastatic Cancers / Metastatic Colon Cancer / Neoplasms, Colorectal1
2RecruitingTreatmentAdenocarcinoma of the Gastro-oesophageal Junction / Adenocarcinoma of the Oesophagus / Adenocarcinoma of the Stomach1
2RecruitingTreatmentAdenocarcinomas1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentBrain Tumor - Metastatic / Cancer, Breast1
2RecruitingTreatmentBreast Adenocarcinoma / Her2-Positive Breast Cancer / Inflammatory Breast Carcinoma / Recurrent Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2RecruitingTreatmentBreast Carcinoma Metastatic in the Brain / Estrogen Receptor Negative / HER2/Neu Negative / HER2/Neu Positive / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentCancer of Breast / Cancer, Breast / Carcinoma, Breast1
2RecruitingTreatmentCancer, Breast8
2RecruitingTreatmentCancer, Breast / Estrogen Receptor Negative Neoplasm / HER-2 Positive Breast Cancer1
2RecruitingTreatmentCancer, Breast / Neoplasms Metastasis1
2RecruitingTreatmentCancer, Breast / Neoplasms, Breast / Tumors, Breast1
2RecruitingTreatmentCancers / Neoplasia / Neoplasms / Tumors1
2RecruitingTreatmentCarcinoma, Breast1
2RecruitingTreatmentCarcinoma, Ductal, Breast1
2RecruitingTreatmentCholangiocarcinoma of the Extrahepatic Bile Duct / Gallbladder Cancer1
2RecruitingTreatmentColorectal Cancers1
2RecruitingTreatmentEpidermal Growth Factor Receptor (EGFR) Protein Overexpression / Malignant Neoplasm of Cardio-esophageal Junction of Stomach / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEstrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / HER2-Negative Breast Cancer / Her2-Positive Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Triple-Negative Breast Cancer (TNBC)1
2RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2RecruitingTreatmentHER-2 Positive Breast Cancer1
2RecruitingTreatmentHER-2 Positive Breast Cancer / Hormone Receptor Positive Tumor1
2RecruitingTreatmentHER2 Positive Breast Cancers1
2RecruitingTreatmentHER2 Positive Breast Cancers / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
2RecruitingTreatmentHER2 Positive Breast Carcinoma / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer1
2RecruitingTreatmentHER2 Positive Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2RecruitingTreatmentHer2-Positive Breast Cancer3
2RecruitingTreatmentHer2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2RecruitingTreatmentMalignant Neoplasm of Stomach2
2RecruitingTreatmentMetastatic Breast Cancer (MBC)2
2RecruitingTreatmentMetastatic Colorectal Cancers1
2RecruitingTreatmentNeoplasms1
2RecruitingTreatmentNeoplasms, Breast5
2RecruitingTreatmentNeoplasms, Esophageal / Stomach Neoplasms1
2RecruitingTreatmentRare Tumor / Refractory Tumors1
2RecruitingTreatmentRefractory Pediatric AML / Refractory Pediatric Solid Tumors / Relapsed Pediatric AML / Relapsed Pediatric Solid Tumors1
2TerminatedTreatmentAdvanced Gastric Cancer1
2TerminatedTreatmentCancer of the Breast / Cancer, Breast / HER2 Positive Breast Cancers / Metastatic Breast Cancer (MBC)1
2TerminatedTreatmentCancer, Breast11
2TerminatedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2TerminatedTreatmentCancer, Breast / Neoplasms Metastasis1
2TerminatedTreatmentCancer, Ovarian1
2TerminatedTreatmentColorectal Cancers1
2TerminatedTreatmentDistal Urethral Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Proximal Urethral Cancer / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Stage IV Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Urethral Cancer Associated With Invasive Bladder Cancer1
2TerminatedTreatmentEsophagus Cancer / Gastroesophageal Junction Cancer / HER-2 Gene Amplification / Malignant Neoplasm of Stomach1
2TerminatedTreatmentHER-2 Positive Metastatic Breast Cancer1
2TerminatedTreatmentHer2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2TerminatedTreatmentHigh-grade Salivary Gland Mucoepidermoid Carcinoma / Recurrent Salivary Gland Cancer / Salivary Gland Acinic Cell Tumor / Salivary Gland Adenocarcinoma / Salivary Gland Poorly Differentiated Carcinoma / Stage IVA Salivary Gland Cancer / Stage IVB Salivary Gland Cancer / Stage IVC Salivary Gland Cancer1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentMalignant Neoplasm of Stomach1
2TerminatedTreatmentMetastatic Breast Cancer (MBC)1
2TerminatedTreatmentNeoplasms, Breast1
2TerminatedTreatmentRelapsed/Refractory Leukemia1
2TerminatedTreatmentUrinary Tract Cancers1
2Unknown StatusTreatmentBreast Diseases / Cancer, Breast / Neoplasms / Neoplasms by Site1
2Unknown StatusTreatmentCancer, Breast9
2Unknown StatusTreatmentCancer, Breast / Metastatic Breast Cancer (MBC) / Progressive Breast Cancer1
2Unknown StatusTreatmentCancer, Breast / Stage II Breast Cancer / Stage III Breast Cancer1
2Unknown StatusTreatmentHER-2 Positive Breast Cancer1
2Unknown StatusTreatmentHead and Neck Carcinoma1
2Unknown StatusTreatmentHepatic Metastases / Metastatic Breast Cancer (MBC)2
2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
2Unknown StatusTreatmentMetastatic Breast Cancer (MBC)1
2Unknown StatusTreatmentStage I Breast Carcinoma / Stage II Breast Cancer1
2WithdrawnDiagnosticCancer, Breast / Lung Cancers / Neoplasms, Breast / Neoplasms, Lung1
2WithdrawnTreatmentCancer, Breast4
2WithdrawnTreatmentNeoplasms, Breast3
2WithdrawnTreatmentPaget's Disease of the Vulva1
2, 3RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2, 3RecruitingTreatmentHer2-Positive Breast Cancer1
2, 3TerminatedTreatmentCancer, Breast / HER2 Positive Breast Cancers1
2, 3TerminatedTreatmentMetastatic Breast Cancer (MBC)1
3Active Not RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Stage IB Esophageal Cancer / Stage IB Esophageal Cancer AJCC v7 / Stage IIA Esophageal Cancer / Stage IIA Esophageal Cancer AJCC v7 / Stage IIB Esophageal Cancer / Stage IIB Esophageal Cancer AJCC v7 / Stage IIIA Esophageal Cancer / Stage IIIA Esophageal Cancer AJCC v7 / Stage IIIB Esophageal Cancer / Stage IIIB Esophageal Cancer AJCC v71
3Active Not RecruitingTreatmentBreast Adenocarcinoma / HER2 Positive Breast Carcinoma / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer1
3Active Not RecruitingTreatmentBreast Cancer Invasive Nos1
3Active Not RecruitingTreatmentCancer, Breast19
3Active Not RecruitingTreatmentCancer, Breast / Neoplasms, Breast2
3Active Not RecruitingTreatmentCancers1
3Active Not RecruitingTreatmentDuctal Breast Carcinoma In Situ / HER2/Neu Positive1
3Active Not RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Positive / Progesterone Receptor Negative / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIC Breast Cancer1
3Active Not RecruitingTreatmentEstrogen Receptor Positive / HER2/Neu Positive / Progesterone Receptor Positive / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
3Active Not RecruitingTreatmentHER2-positive Carcinoma of Breast1
3Active Not RecruitingTreatmentHER2/Neu Positive / Male Breast Carcinoma / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
3Active Not RecruitingTreatmentHER2/Neu Positive / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentMetastatic Brain Tumors1
3Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)3
3Active Not RecruitingTreatmentNeoplasms, Breast4
3CompletedPreventionCancer, Breast1
3CompletedTreatmentCancer, Breast15
3CompletedTreatmentCancer, Breast / Stage IV Breast Cancer1
3CompletedTreatmentCancers1
3CompletedTreatmentHER2 Positive Breast Cancers / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
3CompletedTreatmentHER2 Positive Early or Locally Advanced Breast Cancer1
3CompletedTreatmentHER2-Negative Breast Cancer / Her2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
3CompletedTreatmentHER2-positive Metastatic Breast Cancer / Human Epithelial Receptor (HER)-2 Positive Breast Cancer1
3CompletedTreatmentHER2/Neu Over-expressing Locally Advanced Breast Cancer / Metastatic Breast Cancer (MBC)1
3CompletedTreatmentMalignant Neoplasm of Stomach1
3CompletedTreatmentMetastatic Breast Cancer (MBC)1
3CompletedTreatmentNeoplasms, Breast2
3Enrolling by InvitationTreatmentNeoplasms, Breast1
3Not Yet RecruitingTreatmentHER2 Positive Breast Cancers1
3Not Yet RecruitingTreatmentHER2/Neu Positive / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
3Not Yet RecruitingTreatmentMetastatic Breast Cancer (MBC)1
3RecruitingTreatmentBreast Cancer Model / Cancer, Breast / Effects of Chemotherapy1
3RecruitingTreatmentCancer, Breast5
3RecruitingTreatmentEstrogen Receptor Positive Breast Cancer / HER-2 Positive Breast Cancer1
3RecruitingTreatmentHER-2 Positive Breast Cancer / Neoplasms, Metastatic1
3RecruitingTreatmentHER2 Positive Breast Cancers / Stage I Breast Carcinoma1
3RecruitingTreatmentHER2-positive Locally Advanced or Metastatic Breast Cancer1
3RecruitingTreatmentMalignant Neoplasm of Stomach1
3RecruitingTreatmentMetastatic Breast Cancer (MBC)1
3TerminatedTreatmentCancer, Breast2
3TerminatedTreatmentCancer, Breast / Metastasis / Sur-expressing Her2-neu1
3TerminatedTreatmentCarcinoma, Breast / HER2/Neu Positive / Male Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
3TerminatedTreatmentCardiac Toxicity / Inflammatory carcinoma of the breast / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IV Breast Cancer1
3TerminatedTreatmentMalignant Neoplasm of Stomach1
3TerminatedTreatmentMetastatic Breast Cancer (MBC)1
3Unknown StatusDiagnosticCancer, Breast1
3Unknown StatusTreatmentCancer, Breast6
3Unknown StatusTreatmentMetastatic or Locally Advanced Breast Cancer1
3WithdrawnTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
4Active Not RecruitingTreatmentCancer, Breast1
4CompletedTreatmentCancer, Breast2
4RecruitingTreatmentCancer, Breast1
4RecruitingTreatmentHer-2 Positive Gastric Cancer / Liver Metastasis1
4TerminatedTreatmentMalignant Neoplasm of Stomach1
Not AvailableActive Not RecruitingNot AvailableCancer, Breast / Chemotherapeutic Agent Toxicity / Cognitive/Functional Effects / Long-Term Effects Secondary to Cancer Therapy in Adults / Neurotoxicity / Psychosocial Effects of Cancer and Its Treatment / Tiredness1
Not AvailableActive Not RecruitingNot AvailableCancer, Breast / Neoplasms, Breast1
Not AvailableActive Not RecruitingNot AvailableMalignant Neoplasm of Stomach1
Not AvailableActive Not RecruitingNot AvailableNeoplasms, Breast1
Not AvailableActive Not RecruitingDiagnosticBone Metastases / Hepatic Metastases / Her2-Positive Breast Cancer / Lung Cancer Metastatic / Recurrent Breast Cancer / Soft Tissue Metastases / Stage IV Breast Cancer1
Not AvailableCompletedNot AvailableCancer, Breast4
Not AvailableCompletedNot AvailableCancer, Breast / Cardiac Toxicity1
Not AvailableCompletedNot AvailableCancer, Breast / Metastatic Cancers1
Not AvailableCompletedNot AvailableGastric Cancer, Gastroesophageal Junction Cancer1
Not AvailableCompletedTreatmentCancer, Breast2
Not AvailableCompletedTreatmentCancer, Breast / Cancer, Ovarian / Lung Cancers / Prostate Cancer / Sarcomas / Unspecified Adult Solid Tumor, Protocol Specific1
Not AvailableCompletedTreatmentDuctal Carcinoma In Situ1
Not AvailableRecruitingNot AvailableCancer, Breast2
Not AvailableRecruitingNot AvailableCancer, Breast / Pregnancy1
Not AvailableRecruitingTreatmentAdenocarcinomas1
Not AvailableRecruitingTreatmentHER2 Positive Breast Carcinoma / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
Not AvailableRecruitingTreatmentStage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
Not AvailableSuspendedNot AvailableCancer, Breast1
Not AvailableUnknown StatusNot AvailableCancer, Breast / Cardiac Toxicity / Cardiovascular Complications1
Not AvailableUnknown StatusDiagnosticCancer, Breast / Metastatic Cancers1
Not AvailableWithdrawnTreatmentCancer, Breast / Elderly Patients Diagnosed With Breast Cancer / HER-2 Positive Breast Cancer1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous150 mg
Injection, powder, lyophilized, for solutionIntravenous150 mg/7.4mL
Injection, solutionSubcutaneous600 mg
Kit
Kit
Powder, for solutionIntravenous440 mg
Kit; powder, for solution; solutionIntravenous
Prices
Unit descriptionCostUnit
Herceptin 440 mg Solution Vial3581.2USD vial
Herceptin 440 mg vial3443.46USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2103059No2005-03-222012-06-15Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.415Not Available
isoelectric point8.45Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Transmembrane signaling receptor activity
Specific Function
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, alt...
Gene Name
ERBB2
Uniprot ID
P04626
Uniprot Name
Receptor tyrosine-protein kinase erbB-2
Molecular Weight
137909.27 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Leveque D, Gigou L, Bergerat JP: Clinical pharmacology of trastuzumab. Curr Clin Pharmacol. 2008 Jan;3(1):51-5. [PubMed:18690878]
  3. Lin A, Rugo HS: The role of trastuzumab in early stage breast cancer: current data and treatment recommendations. Curr Treat Options Oncol. 2007 Feb;8(1):47-60. [PubMed:17660958]
  4. Treish I, Schwartz R, Lindley C: Pharmacology and therapeutic use of trastuzumab in breast cancer. Am J Health Syst Pharm. 2000 Nov 15;57(22):2063-76; quiz 2077-9. [PubMed:11098307]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Ubiquitin protein ligase binding
Specific Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TG...
Gene Name
EGFR
Uniprot ID
P00533
Uniprot Name
Epidermal growth factor receptor
Molecular Weight
134276.185 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Curnow RT: Clinical experience with CD64-directed immunotherapy. An overview. Cancer Immunol Immunother. 1997 Nov-Dec;45(3-4):210-5. [PubMed:9435876]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Bowles JA, Weiner GJ: CD16 polymorphisms and NK activation induced by monoclonal antibody-coated target cells. J Immunol Methods. 2005 Sep;304(1-2):88-99. [PubMed:16109421]
  2. Shahied LS, Tang Y, Alpaugh RK, Somer R, Greenspon D, Weiner LM: Bispecific minibodies targeting HER2/neu and CD16 exhibit improved tumor lysis when placed in a divalent tumor antigen binding format. J Biol Chem. 2004 Dec 24;279(52):53907-14. Epub 2004 Oct 7. [PubMed:15471859]
  3. Kubo M, Morisaki T, Kuroki H, Tasaki A, Yamanaka N, Matsumoto K, Nakamura K, Onishi H, Baba E, Katano M: Combination of adoptive immunotherapy with Herceptin for patients with HER2-expressing breast cancer. Anticancer Res. 2003 Nov-Dec;23(6a):4443-9. [PubMed:14666732]
  4. Yamaguchi Y, Hironaka K, Okawaki M, Okita R, Matsuura K, Ohshita A, Toge T: HER2-specific cytotoxic activity of lymphokine-activated killer cells in the presence of trastuzumab. Anticancer Res. 2005 Mar-Apr;25(2A):827-32. [PubMed:15868915]
  5. Xie Z, Guo N, Yu M, Hu M, Shen B: A new format of bispecific antibody: highly efficient heterodimerization, expression and tumor cell lysis. J Immunol Methods. 2005 Jan;296(1-2):95-101. Epub 2004 Nov 19. [PubMed:15680154]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Suzuki E, Niwa R, Saji S, Muta M, Hirose M, Iida S, Shiotsu Y, Satoh M, Shitara K, Kondo M, Toi M: A nonfucosylated anti-HER2 antibody augments antibody-dependent cellular cytotoxicity in breast cancer patients. Clin Cancer Res. 2007 Mar 15;13(6):1875-82. [PubMed:17363544]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Oxygen binding
Specific Function
Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
Gene Name
CYP19A1
Uniprot ID
P11511
Uniprot Name
Aromatase
Molecular Weight
57882.48 Da
References
  1. Preissner S, Kroll K, Dunkel M, Senger C, Goldsobel G, Kuzman D, Guenther S, Winnenburg R, Schroeder M, Preissner R: SuperCYP: a comprehensive database on Cytochrome P450 enzymes including a tool for analysis of CYP-drug interactions. Nucleic Acids Res. 2010 Jan;38(Database issue):D237-43. doi: 10.1093/nar/gkp970. Epub 2009 Nov 24. [PubMed:19934256]

Drug created on June 13, 2005 07:24 / Updated on October 23, 2017 14:13