Identification

Name
Trastuzumab
Accession Number
DB00072  (BTD00098, BIOD00098)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

A recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture.

In December 2017, FDA approved Ogivri (trastuzumab-dkst) as a biosimilar to Herceptin (trastuzumab) for the treatment of patients with breast or metastatic stomach cancer (gastric or gastroesophageal junction adenocarcinoma) whose tumors overexpress the HER2 gene (HER2+). It displays biosimilar properties as Herceptin according to clinical data. While Ogivri is the first biosimilar approved in the U.S. for the treatment of breast cancer or stomach cancer, it is the second biosimilar approved in the U.S. for the treatment of cancer.

Protein structure
Db00072
Protein chemical formula
C6470H10012N1726O2013S42
Protein average weight
145531.5 Da
Sequences
>Anti-HER2 Light chain (1 and 2)
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Anti-HER2 Heavy chain (1 and 2)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • RHUMAB HER2
  • trastuzumab-dkst
External IDs
4D5V8 / ABP 980 / ABP-980 / DMB-3111 / EG-12014 / EG12014 / R-597 / SB-3 / SYD-977 / SYD977
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Gmb H2000-08-28Not applicableEu
HerceptinPowder, for solution440 mgIntravenousHoffmann La Roche1999-08-23Not applicableCanada
HerceptinKit420 mg/20mLGenentech, Inc.1998-09-25Not applicableUs
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Gmb H2000-08-28Not applicableEu
HerceptinKit440 mg/20mLGenentech, Inc.1998-09-25Not applicableUs
HerceptinInjection, powder, for solution150 mgIntravenousRoche Registration Gmb H2000-08-28Not applicableEu
HerceptinInjection, powder, lyophilized, for solution150 mg/7.4mLIntravenousGenentech, Inc.2017-02-10Not applicableUs
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Perjeta-herceptinTrastuzumab (440 mg) + Pertuzumab (420 mg)Kit; Powder, for solution; SolutionIntravenousHoffmann La Roche2013-05-09Not applicableCanada
International/Other Brands
Herclon (Roche)
Categories
UNII
P188ANX8CK
CAS number
180288-69-1

Pharmacology

Indication

For treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2.

Associated Conditions
Pharmacodynamics

Used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death.

Mechanism of action

Trastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells.

TargetActionsOrganism
AReceptor tyrosine-protein kinase erbB-2
antibody
Human
UEpidermal growth factor receptorNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
Absorption

Peak and trough plasma concentrations at steady state (between weeks 16 and 32) approximately 123 and 79 mcg/mL, respectively.

Volume of distribution
  • 44 mL/kg
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of elimination
Not Available
Half life

average 28.5 days. Pharmacokinetics are nonlinear; increased doses are associated with increased mean half-life and decreased clearance.

Clearance

Elimination may involve clearance of IgG through the reticuloendothelial system.

Toxicity

Administration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy.

Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Trastuzumab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Interacting Gene/EnzymeAllele nameGenotype(s)Defining Change(s)Type(s)DescriptionDetails
Receptor tyrosine-protein kinase erbB-2---(A;G)G Allele, heterozygoteADR Directly StudiedPatients with this genotype have increased risk of cardiotoxicity with trastuzumab.Details

Interactions

Drug Interactions
DrugInteraction
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Trastuzumab is combined with 2-Methoxyethanol.
9-(N-methyl-L-isoleucine)-cyclosporin AThe risk or severity of adverse effects can be increased when Trastuzumab is combined with 9-(N-methyl-L-isoleucine)-cyclosporin A.
AbataceptThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Abatacept.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Trastuzumab.
AbetimusThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Abetimus.
AbituzumabThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Abituzumab.
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Trastuzumab.
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Trastuzumab.
ActeosideThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Acteoside.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Trastuzumab.
Food Interactions
Not Available

References

General References
  1. Bange J, Zwick E, Ullrich A: Molecular targets for breast cancer therapy and prevention. Nat Med. 2001 May;7(5):548-52. [PubMed:11329054]
  2. Menard S, Pupa SM, Campiglio M, Tagliabue E: Biologic and therapeutic role of HER2 in cancer. Oncogene. 2003 Sep 29;22(42):6570-8. [PubMed:14528282]
  3. Kute T, Lack CM, Willingham M, Bishwokama B, Williams H, Barrett K, Mitchell T, Vaughn JP: Development of Herceptin resistance in breast cancer cells. Cytometry A. 2004 Feb;57(2):86-93. [PubMed:14750129]
  4. Albanell J, Codony J, Rovira A, Mellado B, Gascon P: Mechanism of action of anti-HER2 monoclonal antibodies: scientific update on trastuzumab and 2C4. Adv Exp Med Biol. 2003;532:253-68. [PubMed:12908564]
  5. Tan AR, Swain SM: Ongoing adjuvant trials with trastuzumab in breast cancer. Semin Oncol. 2003 Oct;30(5 Suppl 16):54-64. [PubMed:14613027]
  6. Nebija D, Kopelent-Frank H, Urban E, Noe CR, Lachmann B: Comparison of two-dimensional gel electrophoresis patterns and MALDI-TOF MS analysis of therapeutic recombinant monoclonal antibodies trastuzumab and rituximab. J Pharm Biomed Anal. 2011 Dec 5;56(4):684-91. doi: 10.1016/j.jpba.2011.07.006. Epub 2011 Jul 18. [PubMed:21813259]
  7. US Patent US6870034B2 (includes Trastuzumab heavy chain sequence) [Link]
  8. Trastuzumab: Antineoplastic agent; a recombinant DNA- derived humanized anti-HER2 monoclonal antibody (complete heavy chain sequence) [File]
External Links
UniProt
P01857
Genbank
J00228
KEGG Drug
D03257
PubChem Substance
46507516
ChEMBL
CHEMBL1201585
Therapeutic Targets Database
DAP000391
PharmGKB
PA451743
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Trastuzumab
ATC Codes
L01XC03 — Trastuzumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (41 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingDiagnosticNeoplasms, Breast1
0CompletedTreatmentCancer, Breast1
0WithdrawnTreatmentAdvanced Solid Tumors / Documented Her2 Overexpression / Metastatic Brain Tumors / Neurologically Stable1
1Active Not RecruitingOtherMetastatic Breast Cancer (MBC)1
1Active Not RecruitingTreatmentAdvanced HER2-positive Breast Cancer / Brain Metastases From HER2 and Breast Cancer1
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentCancer, Breast3
1Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Her2-negative Metastatic Breast Cancer / HER2-positive Metastatic Breast Cancer / Locally Advanced or Early Breast Cancer1
1Active Not RecruitingTreatmentHER2 Positive Metastatic Breast Cancers1
1Active Not RecruitingTreatmentHER2/Neu Positive / Invasive Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v71
1Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
1Active Not RecruitingTreatmentNeoplasms, Breast3
1CompletedNot AvailableHealthy Volunteers4
1CompletedBasic ScienceHealthy Volunteers1
1CompletedTreatmentAbdominal wall neoplasm / Neoplasms, Breast / Neoplasms, Ovarian / Neoplasms, Pancreatic / Stomach Neoplasms1
1CompletedTreatmentAdvanced Adult Primary Liver Cancer / Advanced Gastric Cancer / Anaplastic Thyroid Cancers / Bone Metastases / Carcinoma of the Appendix / Distal Urethral Cancer / Fallopian Tube Cancer / Gastrinoma / Glucagonoma / Hepatic Metastases / Inflammatory carcinoma of the breast / Insulinoma / Localized Unresectable Adult Primary Liver Cancer / Lung Cancer Metastatic / Male Breast Cancer / Malignant Pericardial Effusion / Malignant Pleural Effusions / Metastases to skin / Metastatic Bladder Cancer / Metastatic Colon Cancer / Metastatic Gastrointestinal Carcinoid Tumor / Metastatic Parathyroid Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Newly Diagnosed Carcinoma of Unknown Primary / Non-Small Cell Lung Cancer Recurrent / Occult Non-small Cell Lung Cancer / Pancreatic Polypeptide Tumor / Primary Peritoneal Cavity Cancer / Proximal Urethral Cancer / Pulmonary Carcinoid Tumor / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Adrenocortical Carcinoma / Recurrent Adult Primary Liver Cancer / Recurrent Anal Cancer / Recurrent Bladder Cancer / Recurrent Breast Cancer / Recurrent Carcinoma of Unknown Primary / Recurrent Cervical Cancer / Recurrent Colon Cancer / Recurrent Endometrial Carcinoma / Recurrent Esophageal Cancer / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Recurrent Gastric Cancer / Recurrent Gastrointestinal Carcinoid Tumor / Recurrent Islet Cell Carcinoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Ovarian Epithelial Cancer / Recurrent Pancreatic Cancer / Recurrent Parathyroid Cancer / Recurrent Prostate Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Small Intestine Cancer / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Thyroid Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Recurrent Vaginal Cancer / Recurrent Vulvar Cancer / Renal Cell Cancer, Recurrent / Small Intestine Adenocarcinoma / Somatostatinoma / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Adrenocortical Carcinoma / Stage III Bladder Cancer / Stage III Cervical Cancer / Stage III Colon Cancer / Stage III Endometrial Carcinoma / Stage III Esophageal Cancer / Stage III Follicular Thyroid Cancer / Stage III Gastric Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Ovarian Epithelial Cancer / Stage III Pancreatic Cancer / Stage III Papillary Thyroid Cancer / Stage III Prostate Cancer / Stage III Rectal Cancer / Stage III Renal Cell Cancer / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Vaginal Cancer / Stage III Vulvar Cancer / Stage IIIA Anal Cancer / Stage IIIA Breast Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Anal Cancer / Stage IIIB Breast Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Adrenocortical Carcinoma / Stage IV Anal Cancer / Stage IV Breast Cancer / Stage IV Endometrial Carcinoma / Stage IV Esophageal Cancer / Stage IV Follicular Thyroid Cancer / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Ovarian Epithelial Cancer / Stage IV Pancreatic Cancer / Stage IV Papillary Thyroid Cancer / Stage IV Prostate Cancer / Stage IV Rectal Cancer / Stage IV Renal Cell Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IVA Cervical Cancer / Stage IVA Vaginal Cancer / Stage IVB Cervical Cancer / Stage IVB Vaginal Cancer / Stage IVB Vulvar Cancer / Thyroid Gland Medullary Carcinoma / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer / Urethral Cancer Associated With Invasive Bladder Cancer / WDHA Syndrome1
1CompletedTreatmentAdvanced Cancers1
1CompletedTreatmentAdvanced HER2-positive Breast Cancer or Gastric Cancer1
1CompletedTreatmentAdvanced Solid Malignancies / Malignancies, Hematologic1
1CompletedTreatmentAdvanced Solid Tumors / Malignancies / Tumors1
1CompletedTreatmentBreast Cancer Metastatic1
1CompletedTreatmentBreastcancer1
1CompletedTreatmentCancer, Breast8
1CompletedTreatmentCancer, Breast / Locally Recurrent and Metastatic Breast Cancer / Malignancies / Metastases / Metastatic Cancers / Neoplasms, Breast / Oncology / Tumors / Tumors, Breast / Tumors, Solid1
1CompletedTreatmentCancer, Breast / Metastatic Brain Tumors1
1CompletedTreatmentCancer, Breast / Metastatic Breast Cancer, Locally Advanced Breast Cancer1
1CompletedTreatmentCancer, Breast / Metastatic Cancers1
1CompletedTreatmentCancer, Breast / Tumors, Solid1
1CompletedTreatmentHER-2 Gene Amplification1
1CompletedTreatmentHER-2 Positive Breast Cancer / Metastatic Breast Cancer (MBC)1
1CompletedTreatmentHealthy Volunteers2
1CompletedTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1CompletedTreatmentLocally Advanced Breast Cancer (LABC) / Metastatic Breast Cancer (MBC)1
1CompletedTreatmentMale Breast Cancer / Non-Small Cell Lung Cancer Recurrent / Recurrent Breast Cancer / Recurrent Endometrial Carcinoma / Recurrent Gastric Cancer / Recurrent Ovarian Epithelial Cancer / Refractory Small cell lung cancer1
1CompletedTreatmentMalignancies1
1CompletedTreatmentMetastatic Breast Cancer (MBC)2
1CompletedTreatmentMetastatic or Locally Advanced Solid Tumors1
1CompletedTreatmentNeoplasms, Breast3
1CompletedTreatmentNeoplasms, Breast / Stomach Neoplasms1
1CompletedTreatmentSolid Cancers1
1CompletedTreatmentStage I Breast Carcinoma1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific3
1Not Yet RecruitingTreatmentBreast Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Recurrent Non-Hodgkin Lymphoma / Recurrent Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Breast Cancer AJCC v6 and v71
1Not Yet RecruitingTreatmentCancer, Breast1
1Not Yet RecruitingTreatmentHER-2 protein overexpression / Tumors, Solid1
1RecruitingTreatmentAdvanced Solid Tumors / Colorectal Cancers / EGFR Positive Solid Tumor / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular,Carcinoma / HER2 Positive Gastric Cancer / Her2-Positive Breast Cancer / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Neoplasm of Pancreas / Renal Cell Adenocarcinoma1
1RecruitingTreatmentCancer of Head and Neck / Cancer, Breast / Tumors, Solid1
1RecruitingTreatmentCancer, Advanced / Metastatic Cancers / NonHodgkin Lymphoma / Tumors, Solid1
1RecruitingTreatmentCancer, Breast3
1RecruitingTreatmentCancer, Breast / Tumors, Solid1
1RecruitingTreatmentHER2 Positive Breast Cancers1
1RecruitingTreatmentHER2 Positive Breast Carcinoma / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1RecruitingTreatmentHealthy Volunteers / Neoplasms, Breast1
1RecruitingTreatmentInflammatory carcinoma of the breast1
1RecruitingTreatmentMetastatic Breast Cancer (MBC) / Recurrent Breast Cancer1
1RecruitingTreatmentNeoplasms, Breast1
1TerminatedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Advanced Gastric Cancer / Her2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Recurrent Esophageal Cancer / Recurrent Gastric Cancer / Stage IIIC Breast Cancer / Stage IIIC Esophageal Cancer / Stage IIIC Gastric Cancer / Stage IV Breast Cancer / Stage IV Esophageal Cancer1
1TerminatedTreatmentAdvanced Solid Tumors / Cancer, Breast1
1TerminatedTreatmentAsymptomatic or Low Symptomatic Brain Metastasis in Breast Cancer / HER2 Positive Untreated Metastatic Breast Cancer1
1TerminatedTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
1TerminatedTreatmentNeoplasms1
1TerminatedTreatmentTumors, Solid1
1Unknown StatusTreatmentMetastatic Breast Cancer (MBC)1
1WithdrawnTreatmentCancer, Breast1
1, 2Active Not RecruitingTreatmentBladder Urothelial Carcinoma / Stage I Bladder Cancer / Stage I Bladder Cancer AJCC v6 and v7 / Stage II Bladder Cancer / Stage II Bladder Cancer AJCC v6 and v7 / Stage III Bladder Cancer / Stage III Bladder Cancer AJCC v6 and v71
1, 2Active Not RecruitingTreatmentCancer, Breast2
1, 2Active Not RecruitingTreatmentCancer, Breast / DCIS Breast Cancer1
1, 2Active Not RecruitingTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
1, 2Active Not RecruitingTreatmentCarcinomatous Meningitis / Metastatic Breast Cancer (MBC)1
1, 2Active Not RecruitingTreatmentHER2/Neu Positive / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
1, 2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
1, 2CompletedTreatmentAdvanced Breast Cancer1
1, 2CompletedTreatmentCancer, Breast11
1, 2CompletedTreatmentCancer, Breast / Lung Cancers / Malignant Gliomas / Melanoma / Metastatic Brain Tumors1
1, 2CompletedTreatmentCancer, Breast / Male Breast Cancer / Recurrent Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentCancer, Breast / Neoplasms Metastasis1
1, 2CompletedTreatmentCancer, Breast / Neoplasms, Breast1
1, 2CompletedTreatmentHER-2 Positive Advanced Gastric Cancer1
1, 2CompletedTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentMetastatic Breast Carcinoma1
1, 2CompletedTreatmentOesophageal Carcinoma1
1, 2Not Yet RecruitingTreatmentHER2 Positive Breast Carcinoma / Metastatic Breast Cancer (MBC)1
1, 2Not Yet RecruitingTreatmentMalignant Neoplasm of Stomach1
1, 2RecruitingTreatmentBreast Cancer, Male / Cancer, Breast / Her2-Positive Breast Cancer / Malignant Neoplasm of Female Breast1
1, 2RecruitingTreatmentBreast Diseases / Neoplasms, Breast1
1, 2RecruitingTreatmentCancer, Breast1
1, 2RecruitingTreatmentCancer, Breast / Cholangiocarcinomas / Endometrial Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Neoplasm of Stomach / Malignant Solid Tumours / MPN / MPN (Myeloproliferative Neoplasms) / Multiple Myeloma (MM) / Neoplasms, Endometrial / NSCLC (Non-small Cell Lung Carcinoma) / Solid Tumors and Hematologic Malignancy / Stomach Neoplasms / Transitional Cell Carcinoma / Tumors, Solid / UC (Urothelial Cancer)1
1, 2RecruitingTreatmentCancer, Breast / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentCarcinoma, Breast / HER-2 Positive Breast Cancer / Metastatic Breast Cancer (MBC)1
1, 2RecruitingTreatmentMalignant Neoplasm of Breast1
1, 2RecruitingTreatmentMalignant Neoplasm of Breast / Neoplasms, Breast1
1, 2RecruitingTreatmentMalignant Neoplasm of Stomach1
1, 2RecruitingTreatmentMCRC / Metastatic Colorectal Cancers1
1, 2RecruitingTreatmentRecurrent Breast Cancer1
1, 2TerminatedTreatmentCancer, Advanced / Cancer, Breast / Colorectal Cancers / Esophageal Cancers / Malignant Neoplasm of Stomach1
1, 2TerminatedTreatmentCancer, Breast5
1, 2TerminatedTreatmentCancer, Breast / Her2-Positive Breast Cancer1
1, 2TerminatedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
1, 2TerminatedTreatmentER-positive Breast Cancer / Her2-Positive Breast Cancer1
1, 2TerminatedTreatmentHER-2 Positive Breast Cancer1
1, 2TerminatedTreatmentHER2 + Breast Cancer / Metastatic Breast Cancer (MBC)1
1, 2TerminatedTreatmentMetastatic Breast Cancer (MBC)1
1, 2TerminatedTreatmentNeoplasms1
1, 2TerminatedTreatmentStage IV (Metastatic) Breast Cancer1
1, 2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
1, 2WithdrawnTreatmentBrain and Central Nervous System Tumors / Cancer, Breast / Cognitive/Functional Effects / Drug/Agent Toxicity by Tissue/Organ / Psychosocial Effects of Cancer and Its Treatment1
1, 2WithdrawnTreatmentCancer, Breast2
2Active Not RecruitingNot AvailableAdenocarcinoma of the Gastro-oesophageal Junction / Metastatic Gastric Cancers1
2Active Not RecruitingBasic ScienceCancer, Breast1
2Active Not RecruitingBasic ScienceStage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingOtherCancer, Breast / Locally Advanced Malignant Neoplasm1
2Active Not RecruitingOtherNeoplasms, Breast1
2Active Not RecruitingPreventionCancer, Breast1
2Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction1
2Active Not RecruitingTreatmentAdvanced Breast Cancer / HER2 Amplified / Human Epidermal Growth Factor Receptor 2 (HER2)1
2Active Not RecruitingTreatmentBrain Tumor - Metastatic / Cancer, Breast1
2Active Not RecruitingTreatmentCancer, Breast15
2Active Not RecruitingTreatmentCancer, Breast / Carcinoma of the Breast1
2Active Not RecruitingTreatmentCancer, Breast / HER2-Negative Breast Cancer / Her2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingTreatmentCancer, Breast / Metastatic Brain Tumors / Metastatic Breast Cancer (MBC) / Triple Negative Breast Cancer (TNBC)1
2Active Not RecruitingTreatmentElderly Metastatic Breast Cancer Population1
2Active Not RecruitingTreatmentEndometrial Cancers1
2Active Not RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2Active Not RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2Active Not RecruitingTreatmentGeriatric Health Services / HER2/Neu Positive / Neoplasms, Breast1
2Active Not RecruitingTreatmentHER-2 Positive Breast Cancer2
2Active Not RecruitingTreatmentHER-2 Positive Breast Cancer / Hormone Receptor Positive Tumor1
2Active Not RecruitingTreatmentHER2-Positive Early Stage Breast Cancer1
2Active Not RecruitingTreatmentHer-2 Positive Gastric Cancer / Metastatic or Recurrent Gastric Adenocarcinoma1
2Active Not RecruitingTreatmentHer2-Positive Breast Cancer1
2Active Not RecruitingTreatmentMalignant Tumor of the Breast / Neoplasms, Breast1
2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)3
2Active Not RecruitingTreatmentMetastatic Cancers1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancers1
2Active Not RecruitingTreatmentMetastatic HER2-Positive Breast Cancer1
2Active Not RecruitingTreatmentNeoplasms, Breast3
2Active Not RecruitingTreatmentNeoplasms, Esophageal / Stomach Neoplasms1
2CompletedTreatmentAdenocarcinoma of the Extrahepatic Bile Duct / Adenocarcinoma of the Gallbladder / Neoplasms, Malignant / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer1
2CompletedTreatmentAdvanced Breast Cancer / Cancer, Breast1
2CompletedTreatmentAdvanced Breast Cancer / Cancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentAdvanced HER2-positive Breast Cancer1
2CompletedTreatmentBreast Cancer Metastatic1
2CompletedTreatmentCancer of the Breast / Cancer, Breast / Neoplasms, Breast1
2CompletedTreatmentCancer, Breast69
2CompletedTreatmentCancer, Breast / Cardiac Toxicity1
2CompletedTreatmentCancer, Breast / Circulating Tumor Cells / Human Epidermal Growth Factor 2 Negative Carcinoma of Breast1
2CompletedTreatmentCancer, Breast / HER2 Positive1
2CompletedTreatmentCancer, Breast / Inflammatory carcinoma of the breast / Locally Advanced Breast Cancer (LABC)1
2CompletedTreatmentCancer, Breast / Metastatic Brain Tumors1
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC) / Progressive Breast Cancer1
2CompletedTreatmentCancer, Breast / Neoplasms, Breast2
2CompletedTreatmentCarcinoma, Breast1
2CompletedTreatmentColorectal Cancers1
2CompletedTreatmentERBB2 Gene Amplification / Neoplasms Metastasis / Stomach Neoplasms1
2CompletedTreatmentEndometrial Adenocarcinomas / Recurrent Endometrial Carcinoma / Stage III Endometrial Carcinoma / Stage IV Endometrial Carcinoma1
2CompletedTreatmentEstrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / Her2-Positive Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentEstrogen Receptor-Positive Breast Cancer / Her2-Positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2CompletedTreatmentHER-2 Positive Breast Cancer1
2CompletedTreatmentHER-2 Positive Metastatic Breast Cancer1
2CompletedTreatmentHER2-positive, Newly Diagnosed, Primary Breast Cancer, Neoadjuvant Therapy, Trastuzumab1
2CompletedTreatmentHer2-Positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer2
2CompletedTreatmentHer2-Positive Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentLung Cancers2
2CompletedTreatmentMale Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentMalignant Neoplasm of Pancreas / Neoplasms, Pancreatic1
2CompletedTreatmentMalignant Neoplasm of Stomach3
2CompletedTreatmentMetastatic Bladder Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Squamous Cell Carcinoma of the Bladder / Transitional Cell Carcinoma of the Bladder1
2CompletedTreatmentMetastatic Bladder Cancer / Recurrent Bladder Cancer / Transitional Cell Carcinoma of the Bladder1
2CompletedTreatmentMetastatic Bone Sarcomas1
2CompletedTreatmentMetastatic Breast Cancer (MBC)6
2CompletedTreatmentNeoplasms, Breast13
2CompletedTreatmentNon-Small Cell Lung Cancer Recurrent / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentProstate Cancer2
2CompletedTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentSarcomas2
2CompletedTreatmentStage I Breast Carcinoma / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer1
2CompletedTreatmentStage IV Gastric Cancer With Metastasis1
2CompletedTreatmentUnilateral HER2 Positive Breast Cancer1
2CompletedTreatmentUrinary Tract Cancers1
2CompletedTreatmentUrologic Neoplasms1
2Not Yet RecruitingTreatmentBiliary Tract Cancer / Cholangiocarcinomas / HER-2 Gene Amplification / HER-2 protein overexpression1
2Not Yet RecruitingTreatmentCancer, Breast1
2Not Yet RecruitingTreatmentCancer, Breast / Estrogen Receptor Positive Tumor / Her2-Positive Breast Cancer1
2Not Yet RecruitingTreatmentHER2-Positive Early Breast Cancer1
2Not Yet RecruitingTreatmentLeptomeningeal Disease / Metastatic Breast Cancer (MBC)1
2Not Yet RecruitingTreatmentLocally Advanced Breast Cancer (LABC)1
2RecruitingPreventionCancer, Breast1
2RecruitingTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Carcinoma, Colorectal / Colon Adenocarcinoma / Colorectal Adenocarcinoma / Colorectal Cancers / Colorectal Tumors / ERBB2 Gene Amplification / HER-2 Gene Amplification / HER2/Neu Positive / KRAS wt Allele / Metastatic Cancers / Metastatic Colon Cancer / Neoplasms, Colorectal / NRAS wt Allele / Rectal Adenocarcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Rectal Carcinoma / Stage III Colon Cancer AJCC v7 / Stage III Colorectal Cancer AJCC v7 / Stage III Rectal Cancer AJCC v7 / Stage IIIA Colon Cancer AJCC v7 / Stage IIIA Colorectal Cancer AJCC v7 / Stage IIIA Rectal Cancer AJCC v7 / Stage IIIB Colon Cancer AJCC v7 / Stage IIIB Colorectal Cancer AJCC v7 / Stage IIIB Rectal Cancer AJCC v7 / Stage IIIC Colon Cancer AJCC v7 / Stage IIIC Colorectal Cancer AJCC v7 / Stage IIIC Rectal Cancer AJCC v7 / Stage IV Colon Cancer AJCC v7 / Stage IV Colorectal Cancer AJCC v7 / Stage IV Rectal Cancer AJCC v7 / Stage IVA Colon Cancer AJCC v7 / Stage IVA Colorectal Cancer AJCC v7 / Stage IVA Rectal Cancer AJCC v7 / Stage IVB Colon Cancer AJCC v7 / Stage IVB Colorectal Cancer AJCC v7 / Stage IVB Rectal Cancer AJCC v71
2RecruitingTreatmentAdenocarcinoma of the Gastro-oesophageal Junction / Adenocarcinoma of the Oesophagus / Adenocarcinoma of the Stomach1
2RecruitingTreatmentAdenocarcinomas1
2RecruitingTreatmentAdvanced Malignant Neoplasm / Advanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Uterine Neoplasm / Melanoma / Oesophageal Carcinoma / Ovarian Carcinoma / Plasma Cell Myeloma / Prostate Cancer / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Solid Neoplasm / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Solid Neoplasms / Thyroid Gland Carcinoma / Uterine Corpus Cancer1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentBiliary Cancer / Bladder Cancers / Neoplasms / Salivary Cancer / Tumors, Solid1
2RecruitingTreatmentBreast Adenocarcinoma / Her2-Positive Breast Cancer / Inflammatory Breast Carcinoma / Recurrent Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2RecruitingTreatmentBreast Cancer Metastatic1
2RecruitingTreatmentBreast Carcinoma Metastatic in the Brain / Estrogen Receptor Negative / HER2/Neu Negative / HER2/Neu Positive / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentCancer of Unknown Primary Site1
2RecruitingTreatmentCancer of the Breast / Cancer, Breast / Carcinoma, Breast1
2RecruitingTreatmentCancer, Breast6
2RecruitingTreatmentCancer, Breast / Chest Wall Disease1
2RecruitingTreatmentCancer, Breast / Estrogen Receptor Negative Neoplasm / HER-2 Positive Breast Cancer1
2RecruitingTreatmentCancer, Breast / Neoplasms Metastasis1
2RecruitingTreatmentCancer, Breast / Neoplasms, Breast / Tumors, Breast1
2RecruitingTreatmentCarcinoma, Breast1
2RecruitingTreatmentCarcinoma, Ductal, Breast1
2RecruitingTreatmentCentral Nervous System Metastases / HER2-positive Metastatic Breast Cancer1
2RecruitingTreatmentCholangiocarcinoma of the Extrahepatic Bile Duct / Gallbladder Cancer1
2RecruitingTreatmentColon Adenocarcinoma / ERBB2 Gene Amplification / Rectal Adenocarcinoma / Recurrent Colon Carcinoma / Recurrent Rectal Carcinoma / Stage III Colon Cancer AJCC v7 / Stage III Rectal Cancer AJCC v7 / Stage IIIA Colon Cancer AJCC v7 / Stage IIIA Rectal Cancer AJCC v7 / Stage IIIB Colon Cancer AJCC v7 / Stage IIIB Rectal Cancer AJCC v7 / Stage IIIC Colon Cancer AJCC v7 / Stage IIIC Rectal Cancer AJCC v7 / Stage IV Colon Cancer AJCC v7 / Stage IV Rectal Cancer AJCC v7 / Stage IVA Colon Cancer AJCC v7 / Stage IVA Rectal Cancer AJCC v7 / Stage IVB Colon Cancer AJCC v7 / Stage IVB Rectal Cancer AJCC v71
2RecruitingTreatmentEpidermal Growth Factor Receptor (EGFR) Protein Overexpression / Malignant Neoplasm of Cardio-esophageal Junction of Stomach / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / Estrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / HER2-Negative Breast Cancer / Her2-Positive Breast Cancer / HER2/Neu Negative / HER2/Neu Positive / Invasive Breast Carcinoma / Progesterone Receptor Negative / Progesterone Receptor Positive / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Triple-Negative Breast Cancer (TNBC) / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentFibrolamellar Carcinoma / Malignant Solid Tumours / Tumors, Solid1
2RecruitingTreatmentHER-2 Positive Breast Cancer1
2RecruitingTreatmentHER2 Positive Breast Cancers1
2RecruitingTreatmentHER2 Positive Breast Cancers / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
2RecruitingTreatmentHER2 Positive Breast Carcinoma / Stage I Breast Cancer AJCC v7 / Stage IA Breast Cancer / Stage IA Breast Cancer AJCC v7 / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage II Breast Cancer AJCC v6 and v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v71
2RecruitingTreatmentHER2 Positive Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2RecruitingTreatmentHer-2 Positive Gastric Cancer / Metastatic Cancers1
2RecruitingTreatmentHer2-Positive Breast Cancer2
2RecruitingTreatmentHer2-Positive Breast Cancer / Operable Breast Cancer1
2RecruitingTreatmentHer2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2RecruitingTreatmentMalignancies / Neoplasms / Tumors1
2RecruitingTreatmentMalignant Neoplasm of Stomach2
2RecruitingTreatmentMetastatic Breast Cancer (MBC)2
2RecruitingTreatmentMetastatic Colorectal Cancers1
2RecruitingTreatmentNeoplasms, Breast4
2RecruitingTreatmentRare Tumor / Refractory Tumors1
2RecruitingTreatmentRefractory Pediatric AML / Refractory Pediatric Solid Tumors / Relapsed Pediatric AML / Relapsed Pediatric Solid Tumors1
2SuspendedTreatmentColorectal Cancers1
2TerminatedTreatmentAdvanced Gastric Cancer1
2TerminatedTreatmentCancer of the Breast / Cancer, Breast / HER2 Positive Breast Cancers / Metastatic Breast Cancer (MBC)1
2TerminatedTreatmentCancer of the Ovary1
2TerminatedTreatmentCancer, Breast12
2TerminatedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2TerminatedTreatmentCancer, Breast / Neoplasms Metastasis1
2TerminatedTreatmentColorectal Cancers1
2TerminatedTreatmentDistal Urethral Cancer / Metastatic Bladder Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Proximal Urethral Cancer / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Transitional Cell Carcinoma of the Bladder / Urethral Cancer Associated With Invasive Bladder Cancer1
2TerminatedTreatmentEsophagus Cancer / Gastroesophageal Junction Cancer / HER-2 Gene Amplification / Malignant Neoplasm of Stomach1
2TerminatedTreatmentHER-2 Positive Metastatic Breast Cancer1
2TerminatedTreatmentHer2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2TerminatedTreatmentHigh-grade Salivary Gland Mucoepidermoid Carcinoma / Recurrent Salivary Gland Cancer / Salivary Gland Acinic Cell Tumor / Salivary Gland Adenocarcinoma / Salivary Gland Poorly Differentiated Carcinoma / Stage IVA Salivary Gland Cancer / Stage IVB Salivary Gland Cancer / Stage IVC Salivary Gland Cancer1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentMalignant Neoplasm of Stomach1
2TerminatedTreatmentMetastatic Breast Cancer (MBC)1
2TerminatedTreatmentNeoplasms, Breast1
2TerminatedTreatmentRelapsed/Refractory Leukemia1
2TerminatedTreatmentUrinary Tract Cancers1
2Unknown StatusTreatmentBreast Diseases / Cancer, Breast / Neoplasms / Neoplasms by Site1
2Unknown StatusTreatmentCancer, Breast6
2Unknown StatusTreatmentCancer, Breast / Stage II Breast Cancer / Stage III Breast Cancer1
2Unknown StatusTreatmentHER-2 Positive Breast Cancer1
2Unknown StatusTreatmentHead and Neck Carcinoma1
2Unknown StatusTreatmentHepatic Metastases / Metastatic Breast Cancer (MBC)2
2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
2Unknown StatusTreatmentMetastatic Breast Cancer (MBC)1
2WithdrawnDiagnosticCancer, Breast / Lung Cancers / Neoplasms, Breast / Neoplasms, Lung1
2WithdrawnTreatmentBreast Cancer Stage II / Breast Cancer Stage III / Cancer, Breast1
2WithdrawnTreatmentCancer, Breast4
2WithdrawnTreatmentNeoplasms, Breast3
2WithdrawnTreatmentPaget's Disease of the Vulva1
2, 3Active Not RecruitingTreatmentGastric Adenocarcinoma1
2, 3Active Not RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2, 3CompletedTreatmentCancer, Breast1
2, 3RecruitingTreatmentHer2-Positive Breast Cancer1
2, 3TerminatedTreatmentCancer, Breast / HER2 Positive Breast Cancers1
2, 3TerminatedTreatmentMetastatic Breast Cancer (MBC)1
3Active Not RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Stage IB Esophageal Cancer / Stage IB Esophageal Cancer AJCC v7 / Stage IIA Esophageal Cancer / Stage IIA Esophageal Cancer AJCC v7 / Stage IIB Esophageal Cancer / Stage IIB Esophageal Cancer AJCC v7 / Stage IIIA Esophageal Cancer / Stage IIIA Esophageal Cancer AJCC v7 / Stage IIIB Esophageal Cancer / Stage IIIB Esophageal Cancer AJCC v71
3Active Not RecruitingTreatmentBreast Adenocarcinoma / HER2 Positive Breast Carcinoma / Stage IA Breast Cancer / Stage IA Breast Cancer AJCC v7 / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v71
3Active Not RecruitingTreatmentBreast Cancer Invasive Nos1
3Active Not RecruitingTreatmentCancer, Breast15
3Active Not RecruitingTreatmentCancer, Breast / Neoplasms, Breast2
3Active Not RecruitingTreatmentDuctal Breast Carcinoma In Situ / HER2/Neu Positive1
3Active Not RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Positive / Progesterone Receptor Negative / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Stage IA Breast Cancer / Stage IA Breast Cancer AJCC v7 / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v71
3Active Not RecruitingTreatmentEstrogen Receptor Positive / HER2/Neu Positive / Progesterone Receptor Positive / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v71
3Active Not RecruitingTreatmentHER2 Positive Breast Cancers1
3Active Not RecruitingTreatmentHER2-positive Carcinoma of Breast1
3Active Not RecruitingTreatmentHER2/Neu Positive / Male Breast Carcinoma / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v71
3Active Not RecruitingTreatmentHER2/Neu Positive / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)4
3Active Not RecruitingTreatmentNeoplasms, Breast5
3CompletedPreventionCancer, Breast1
3CompletedTreatmentCancer, Breast21
3CompletedTreatmentCancer, Breast / Neoplasms, Breast1
3CompletedTreatmentCancer, Breast / Stage IV Breast Cancer1
3CompletedTreatmentHER2 Positive Breast Cancers / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
3CompletedTreatmentHER2 Positive Early or Locally Advanced Breast Cancer1
3CompletedTreatmentHER2-Negative Breast Cancer / Her2-Positive Breast Cancer / Recurrent Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
3CompletedTreatmentHER2-positive Metastatic Breast Cancer / Human Epithelial Receptor (HER)-2 Positive Breast Cancer1
3CompletedTreatmentHER2/Neu Over-expressing Locally Advanced Breast Cancer / Metastatic Breast Cancer (MBC)1
3CompletedTreatmentMalignancies2
3CompletedTreatmentMalignant Neoplasm of Stomach1
3CompletedTreatmentMetastatic Brain Tumors1
3CompletedTreatmentMetastatic Breast Cancer (MBC)1
3CompletedTreatmentNeoplasms, Breast3
3Not Yet RecruitingOtherBreast Cancer Invasive Nos1
3Not Yet RecruitingOtherNeoplasms, Breast1
3Not Yet RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Positive / Recurrent Breast Carcinoma / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v71
3Not Yet RecruitingTreatmentCancer, Breast2
3RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Neoplasm, Gastric1
3RecruitingTreatmentBreast Cancer Model / Cancer, Breast / Effects of Chemotherapy1
3RecruitingTreatmentCancer, Breast5
3RecruitingTreatmentCancer, Breast / Her2-Positive Breast Cancer / Neoplasms, Breast / Stage II Breast Cancer / Stage IIIA Breast Cancer1
3RecruitingTreatmentEstrogen Receptor Positive Breast Cancer / HER-2 Positive Breast Cancer1
3RecruitingTreatmentHER-2 Positive Breast Cancer / Neoplasms, Metastatic1
3RecruitingTreatmentHER2 Positive Breast Cancers / Stage I Breast Carcinoma1
3RecruitingTreatmentHER2-positive Locally Advanced or Metastatic Breast Cancer1
3RecruitingTreatmentHer2-Positive Breast Cancer1
3RecruitingTreatmentMalignant Neoplasm of Stomach1
3RecruitingTreatmentMetastatic Breast Cancer (MBC)2
3RecruitingTreatmentStage I Breast Carcinoma1
3TerminatedTreatmentCancer, Breast2
3TerminatedTreatmentCancer, Breast / Metastasis / Sur-expressing Her2-neu1
3TerminatedTreatmentCarcinoma, Breast / HER2/Neu Positive / Male Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
3TerminatedTreatmentCardiac Toxicity / Inflammatory carcinoma of the breast / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IV Breast Cancer1
3TerminatedTreatmentMalignant Neoplasm of Stomach1
3Unknown StatusDiagnosticCancer, Breast1
3Unknown StatusTreatmentCancer, Breast4
3Unknown StatusTreatmentMetastatic or Locally Advanced Breast Cancer1
3WithdrawnTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
4CompletedTreatmentCancer, Breast3
4RecruitingTreatmentCancer, Breast1
4RecruitingTreatmentHer-2 Positive Gastric Cancer / Liver Metastasis1
4TerminatedTreatmentMalignant Neoplasm of Stomach1
Not AvailableActive Not RecruitingNot AvailableCancer, Breast / Neoplasms, Breast1
Not AvailableActive Not RecruitingDiagnosticBone Metastases / Hepatic Metastases / Her2-Positive Breast Cancer / Lung Cancer Metastatic / Recurrent Breast Cancer / Soft Tissue Metastases / Stage IV Breast Cancer1
Not AvailableCompletedNot AvailableCancer, Breast5
Not AvailableCompletedNot AvailableCancer, Breast / Cardiac Toxicity1
Not AvailableCompletedNot AvailableCancer, Breast / Cardiac Toxicity / Cardiovascular Complications1
Not AvailableCompletedNot AvailableCancer, Breast / Chemotherapeutic Agent Toxicity / Cognitive/Functional Effects / Long-Term Effects Secondary to Cancer Therapy in Adults / Neurologic toxicity / Psychosocial Effects of Cancer and Its Treatment / Tiredness1
Not AvailableCompletedNot AvailableCancer, Breast / Metastatic Cancers1
Not AvailableCompletedNot AvailableGastric Cancer, Gastroesophageal Junction Cancer1
Not AvailableCompletedNot AvailableMalignant Neoplasm of Stomach1
Not AvailableCompletedTreatmentCancer of the Ovary / Cancer, Breast / Lung Cancers / Prostate Cancer / Sarcomas / Unspecified Adult Solid Tumor, Protocol Specific1
Not AvailableCompletedTreatmentCancer, Breast2
Not AvailableCompletedTreatmentDuctal Carcinoma In Situ1
Not AvailableCompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Breast Cancer (MBC) / Sarcomas / Tumors, Solid1
Not AvailableNot Yet RecruitingNot AvailableObservational / Prospective1
Not AvailableRecruitingNot AvailableCancer, Breast2
Not AvailableRecruitingNot AvailableCancer, Breast / Pregnancy1
Not AvailableRecruitingNot AvailableCancer, Treatment-Related / Cardiovascular Morbidity / Toxicity Due to Chemotherapy1
Not AvailableRecruitingNot AvailableHer2-Positive Breast Cancer1
Not AvailableRecruitingTreatmentAdenocarcinomas1
Not AvailableRecruitingTreatmentHER2 Positive Breast Carcinoma / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
Not AvailableRecruitingTreatmentStage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
Not AvailableSuspendedNot AvailableCancer, Breast1
Not AvailableTerminatedNot AvailableCancer, Breast1
Not AvailableUnknown StatusDiagnosticCancer, Breast / Metastatic Cancers1
Not AvailableWithdrawnTreatmentCancer, Breast / Elderly Patients Diagnosed With Breast Cancer / HER-2 Positive Breast Cancer1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • DSM Corp.
  • F Hoffmann-La Roche Ltd.
  • Genentech Inc.
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous150 mg
Injection, powder, lyophilized, for solutionIntravenous150 mg/7.4mL
Injection, solutionSubcutaneous600 mg
Kit420 mg/20mL
Kit440 mg/20mL
Powder, for solutionIntravenous440 mg
Kit; powder, for solution; solutionIntravenous
Prices
Unit descriptionCostUnit
Herceptin 440 mg Solution Vial3581.2USD vial
Herceptin 440 mg vial3443.46USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2103059No2005-03-222012-06-15Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.415Not Available
isoelectric point8.45Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Transmembrane signaling receptor activity
Specific Function
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, alt...
Gene Name
ERBB2
Uniprot ID
P04626
Uniprot Name
Receptor tyrosine-protein kinase erbB-2
Molecular Weight
137909.27 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Leveque D, Gigou L, Bergerat JP: Clinical pharmacology of trastuzumab. Curr Clin Pharmacol. 2008 Jan;3(1):51-5. [PubMed:18690878]
  3. Lin A, Rugo HS: The role of trastuzumab in early stage breast cancer: current data and treatment recommendations. Curr Treat Options Oncol. 2007 Feb;8(1):47-60. [PubMed:17660958]
  4. Treish I, Schwartz R, Lindley C: Pharmacology and therapeutic use of trastuzumab in breast cancer. Am J Health Syst Pharm. 2000 Nov 15;57(22):2063-76; quiz 2077-9. [PubMed:11098307]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Ubiquitin protein ligase binding
Specific Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TG...
Gene Name
EGFR
Uniprot ID
P00533
Uniprot Name
Epidermal growth factor receptor
Molecular Weight
134276.185 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Curnow RT: Clinical experience with CD64-directed immunotherapy. An overview. Cancer Immunol Immunother. 1997 Nov-Dec;45(3-4):210-5. [PubMed:9435876]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Bowles JA, Weiner GJ: CD16 polymorphisms and NK activation induced by monoclonal antibody-coated target cells. J Immunol Methods. 2005 Sep;304(1-2):88-99. [PubMed:16109421]
  2. Shahied LS, Tang Y, Alpaugh RK, Somer R, Greenspon D, Weiner LM: Bispecific minibodies targeting HER2/neu and CD16 exhibit improved tumor lysis when placed in a divalent tumor antigen binding format. J Biol Chem. 2004 Dec 24;279(52):53907-14. Epub 2004 Oct 7. [PubMed:15471859]
  3. Kubo M, Morisaki T, Kuroki H, Tasaki A, Yamanaka N, Matsumoto K, Nakamura K, Onishi H, Baba E, Katano M: Combination of adoptive immunotherapy with Herceptin for patients with HER2-expressing breast cancer. Anticancer Res. 2003 Nov-Dec;23(6a):4443-9. [PubMed:14666732]
  4. Yamaguchi Y, Hironaka K, Okawaki M, Okita R, Matsuura K, Ohshita A, Toge T: HER2-specific cytotoxic activity of lymphokine-activated killer cells in the presence of trastuzumab. Anticancer Res. 2005 Mar-Apr;25(2A):827-32. [PubMed:15868915]
  5. Xie Z, Guo N, Yu M, Hu M, Shen B: A new format of bispecific antibody: highly efficient heterodimerization, expression and tumor cell lysis. J Immunol Methods. 2005 Jan;296(1-2):95-101. Epub 2004 Nov 19. [PubMed:15680154]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Suzuki E, Niwa R, Saji S, Muta M, Hirose M, Iida S, Shiotsu Y, Satoh M, Shitara K, Kondo M, Toi M: A nonfucosylated anti-HER2 antibody augments antibody-dependent cellular cytotoxicity in breast cancer patients. Clin Cancer Res. 2007 Mar 15;13(6):1875-82. [PubMed:17363544]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Oxygen binding
Specific Function
Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
Gene Name
CYP19A1
Uniprot ID
P11511
Uniprot Name
Aromatase
Molecular Weight
57882.48 Da
References
  1. Preissner S, Kroll K, Dunkel M, Senger C, Goldsobel G, Kuzman D, Guenther S, Winnenburg R, Schroeder M, Preissner R: SuperCYP: a comprehensive database on Cytochrome P450 enzymes including a tool for analysis of CYP-drug interactions. Nucleic Acids Res. 2010 Jan;38(Database issue):D237-43. doi: 10.1093/nar/gkp970. Epub 2009 Nov 24. [PubMed:19934256]

Drug created on June 13, 2005 07:24 / Updated on November 13, 2018 07:44