Trastuzumab

Identification

Name
Trastuzumab
Accession Number
DB00072  (BTD00098, BIOD00098)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Produced in CHO cell cultures, trastuzumab is a recombinant IgG1 kappa, humanized monoclonal antibody 6 that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein (HER2) Label. It is used as a treatment of human epidermal growth factor receptor (HER)-2+ metastatic breast cancer, where there is a proven amplification of the HER-2 oncogene or over-expression of the HER-2 protein in tumours. It is suggested that the overexpression or gene amplification of HER2 has been found in about 20–30% of breast cancers and elevated activation of HER2 triggers multiple downstream pathways leading to abnormal proliferation of cancer cells 4. Trastuzumab binds to HER2 and suppresses cancer cells growth, proliferation, and survival directly and indirectly 4.

In December 2017, FDA approved Ogivri (trastuzumab-dkst) as a biosimilar to Herceptin (trastuzumab) for the treatment of patients with breast or metastatic stomach cancer (gastric or gastroesophageal junction adenocarcinoma) whose tumors overexpress the HER2 gene (HER2+). It displays biosimilar properties as Herceptin according to clinical data. While Ogivri is the first biosimilar approved in the U.S. for the treatment of breast cancer or stomach cancer, it is the second biosimilar approved in the U.S. for the treatment of cancer. Herzuma (trastuzumab-pkrb) is a biosimilar drug approved in December 2018 for the treatment of HER2-overexpressing breast cancer. KANJINTI (trastuzumab-anns) is another biosimilar approved by the FDA in June 2019.[L6715]

Protein structure
Db00072
Protein chemical formula
C6470H10012N1726O2013S42
Protein average weight
145531.5 Da
Sequences
>Anti-HER2 Light chain (1 and 2)
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Anti-HER2 Heavy chain (1 and 2)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • RHUMAB HER2
  • trastuzumab-anns
  • trastuzumab-dkst
  • trastuzumab-dttb
  • trastuzumab-pkrb
  • trastuzumab-qyyp
External IDs
4D5V8 / ABP 980 / ABP-980 / DMB-3111 / EG-12014 / EG12014 / R-597 / SB-3 / SYD-977 / SYD977
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HerceptinInjection, powder, lyophilized, for solution150 mg/7.4mLIntravenousGenentech, Inc.2017-02-10Not applicableUs
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Gmb H2000-08-28Not applicableEu
Herceptin420 mg/20mLIntravenousGenentech, Inc.1998-09-25Not applicableUs
HerceptinInjection, powder, for solution150 mgIntravenousRoche Registration Gmb H2000-08-28Not applicableEu
HerceptinPowder, for solution440 mgIntravenousHoffmann La Roche1999-08-23Not applicableCanada
Herceptin440 mg/20mLIntravenousGenentech, Inc.1998-09-25Not applicableUs
HerceptinInjection, solution600 mgSubcutaneousRoche Registration Gmb H2000-08-28Not applicableEu
Herceptin ScSolutionSubcutaneousHoffmann La Roche2018-10-12Not applicableCanada
HerzumaInjection, powder, lyophilized, for solution150 mg/20mLIntravenousCephalon, Inc.2020-03-16Not applicableUs
Herzuma420 mg/50mLIntravenousCephalon, Inc.2020-03-16Not applicableUs
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Herceptin HylectaTrastuzumab (600 mg/5mL) + Vorhyaluronidase alfa (10000 U/5mL)Injection, solutionSubcutaneousGenentech, Inc.2019-02-28Not applicableUs
OgivriTrastuzumab (440 mg) + Water (20 ml)Powder, for solutionIntravenousBgp Pharma Ulc2019-06-06Not applicableCanada
Perjeta-herceptinTrastuzumab (440 mg) + Pertuzumab (420 mg)Kit; Powder, for solution; SolutionIntravenousHoffmann La Roche2013-05-09Not applicableCanada
International/Other Brands
Herclon (Roche)
Categories
UNII
P188ANX8CK
CAS number
180288-69-1

Pharmacology

Indication

Indicated for treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2. The intravenous powder for solution, OGIVRI, is approved in Canada for early breast cancer, metastatic breast cancer, and gastric cancer, provided these cancers overexpress HER211.

Associated Conditions
Pharmacodynamics

Trastuzumab exerts an antitumour activity and is used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 20%-30% of primary breast cancers 7 thus HER2 presents as a useful therapeutic target for the treatment of breast cancers. Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumour cells that overexpress HER2. It works as a mediator of antibody-dependent cellular cytotoxicity, where it binds as an antibody to cells over-expressing HER2, leading to preferential cell death. Trastuzumab was also shown to inhibit angiogenesis of tumor cells in vivo 4. Higher doses and longer dosing intervals show no significant benefit over standard dose schedules 6. In patients with HER2 positive solid tumours, trastuzumab did not exert any clinically significant QTc interval duration Label.

Mechanism of action

Trastuzumab is a recombinant humanized IgG1 monoclonal antibody against the HER-2 receptor, a member of the epidermal growth factor receptors which is a photo-oncogene. Over-expressed in breast tumour cells, HER-2 overamplifies the signal provided by other receptors of the HER family by forming heterodimers 4. The HER-2 receptor is a transmembrane tyrosine kinase receptor that consists of an extracellular ligand-binding domain, a transmembrane region, and an intracellular or cytoplasmic tyrosine kinase domain. It is activated by the formation of homodimers or heterodimers with other EGFR proteins, leading to dimerization and autophosphorylation and/or transphosphorylation of specific tyrosine residues in EGFR intracellular domains 4. Further downstream molecular signaling cascades are activated, such as the Ras/Raf/mitogen-activated protein kinase (MAPK), the phosphoinositide 3-kinase/Akt, and the phospholipase Cγ (PLCγ)/protein kinase C (PKC) pathways that promote cell growth and survival and cell cycle progression 4. Due to upregulation of HER-2 in tumour cells, hyperactivation of these signaling pathways and abnormal cell proliferation is observed. Trastuzumab binds to the extracellular ligand-binding domain and blocks the cleavage of the extracellular domain of HER-2 to induce its antibody-induced receptor downmodulation 4, and subsequently inhibits HER-2-mediated intracellular signaling cascades. Inhibition of MAPK and PI3K/Akt pathways lead to an increase in cell cycle arrest, and the suppression of cell growth and proliferation 4. Trastuzumab also mediates the activation of antibody-dependent cell-mediated cytotoxicity (ADCC) 6 by attracting the immune cells, such as natural killer (NK) cells, to tumor sites that overexpress HER-2 4. While the drug alone has a minimal potential to induce complement-dependent cytotoxicity (CDC),8 one study demonstrated increased therapeutic effectiveness and a synergistic effect on uterine serous carcinoma cells in vitro when used in combination with pertuzumab, which also has minor effects on CDC alone. This study showed that only the combination of both cell-bound antibodies would be sufficient to bind and activate the complement component 1q (C1q) required to initiate the complement cascade reaction.9

Intrinsic trastuzumab resistance has been noted for some patients with HER-2 positive breast cancer. Mechanisms involving trastuzumab resistance include deficiency of phosphatase and tensin homologue and activation of phosphoinositide 3-kinase, and the overexpression of other surface receptors, such as insulin-like growth factor 6.

TargetActionsOrganism
AReceptor tyrosine-protein kinase erbB-2
antibody
Humans
UEpidermal growth factor receptorNot AvailableHumans
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHumans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Peak and trough plasma concentrations at steady state (between weeks 16 and 32) were approximately 123 and 79 mcg/mL, respectively. At the highest weekly dose studied (500 mg), mean peak serum concentration was 377 mcg/mL Label.

Volume of distribution

Volume of distribution is about 44 mL/kg, which is approximately similar to that of the serum volume Label.

Protein binding

Information not available.

Metabolism

After it binds to HER-2, trastuzumab is likely to be metabolized nonspecifically into smaller peptides and amino acids 6.

Route of elimination

Complex elimination is mediated by epithelial cells in a dose-dependent (nonlinear) fashion 6. The elimination of antibodies from the plasma is complex and dependent on factors such as genetics and the clinical status of the patient. The renal excretion of trastuzumab is very low 6.

Half life

The terminal half life is approximately 28 days 6, but may average at 2 and 12 days at the 10 and 500 mg dose levels Label. The washout period is up to 24 weeks after cessation of trastuzumab treatment 6. Pharmacokinetics are nonlinear; increased doses are associated with increased mean half-life and decreased clearance Label.

Clearance

Information not available.

Toxicity

Administration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy. Oral LD50 value in rat was 5110 mg/kg and the oral lowest published toxic dose (TDlo) value in rat was 16000 mg/kg MSDS. The carcinogenic potential of trastuzumab has not been investigated yet, but there was no evidence of mutagenic activity or chromosomal damage in vitro Label. Parenteral trastuzumab potentially causing fetal toxicity has not been elucidated; however, in a fertility study of female Cynomolgus monkeys, there has been no evidence of impaired fertility, as measured by menstrual cycle duration and female sex hormone levels upon administration of doses up to 25 times the weekly recommended human dose of 2 mg/kg of trastuzumab Label.

Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Trastuzumab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Interacting Gene/EnzymeAllele nameGenotype(s)Defining Change(s)Type(s)DescriptionDetails
Receptor tyrosine-protein kinase erbB-2---(A;G)G Allele, heterozygoteADR Directly StudiedPatients with this genotype have increased risk of cardiotoxicity with trastuzumab.Details

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
2-MethoxyethanolTrastuzumab may increase the neutropenic activities of 2-Methoxyethanol.
9-(N-methyl-L-isoleucine)-cyclosporin ATrastuzumab may increase the neutropenic activities of 9-(N-methyl-L-isoleucine)-cyclosporin A.
AbataceptTrastuzumab may increase the neutropenic activities of Abatacept.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Trastuzumab.
AbetimusTrastuzumab may increase the neutropenic activities of Abetimus.
AbituzumabThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Abrilumab.
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Trastuzumab.
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Trastuzumab.
ActeosideTrastuzumab may increase the neutropenic activities of Acteoside.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
No interactions found.

References

General References
  1. Bange J, Zwick E, Ullrich A: Molecular targets for breast cancer therapy and prevention. Nat Med. 2001 May;7(5):548-52. [PubMed:11329054]
  2. Menard S, Pupa SM, Campiglio M, Tagliabue E: Biologic and therapeutic role of HER2 in cancer. Oncogene. 2003 Sep 29;22(42):6570-8. [PubMed:14528282]
  3. Kute T, Lack CM, Willingham M, Bishwokama B, Williams H, Barrett K, Mitchell T, Vaughn JP: Development of Herceptin resistance in breast cancer cells. Cytometry A. 2004 Feb;57(2):86-93. [PubMed:14750129]
  4. Albanell J, Codony J, Rovira A, Mellado B, Gascon P: Mechanism of action of anti-HER2 monoclonal antibodies: scientific update on trastuzumab and 2C4. Adv Exp Med Biol. 2003;532:253-68. [PubMed:12908564]
  5. Tan AR, Swain SM: Ongoing adjuvant trials with trastuzumab in breast cancer. Semin Oncol. 2003 Oct;30(5 Suppl 16):54-64. [PubMed:14613027]
  6. Boekhout AH, Beijnen JH, Schellens JH: Trastuzumab. Oncologist. 2011;16(6):800-10. doi: 10.1634/theoncologist.2010-0035. Epub 2011 May 31. [PubMed:21632460]
  7. Vu T, Claret FX: Trastuzumab: updated mechanisms of action and resistance in breast cancer. Front Oncol. 2012 Jun 18;2:62. doi: 10.3389/fonc.2012.00062. eCollection 2012. [PubMed:22720269]
  8. Rogers LM, Veeramani S, Weiner GJ: Complement in monoclonal antibody therapy of cancer. Immunol Res. 2014 Aug;59(1-3):203-10. doi: 10.1007/s12026-014-8542-z. [PubMed:24906530]
  9. Mamidi S, Cinci M, Hasmann M, Fehring V, Kirschfink M: Lipoplex mediated silencing of membrane regulators (CD46, CD55 and CD59) enhances complement-dependent anti-tumor activity of trastuzumab and pertuzumab. Mol Oncol. 2013 Jun;7(3):580-94. doi: 10.1016/j.molonc.2013.02.011. Epub 2013 Feb 20. [PubMed:23474221]
  10. US Patent US6870034B2 (includes Trastuzumab heavy chain sequence) [Link]
  11. OGIVRI (Trastuzumab) Health Canada Product Information [Link]
  12. FDA Approved Drug Products: Herceptin (trastuzumab) for intravenous injection [Link]
  13. Trastuzumab: Antineoplastic agent; a recombinant DNA- derived humanized anti-HER2 monoclonal antibody (complete heavy chain sequence) [File]
External Links
UniProt
P01857
Genbank
J00228
KEGG Drug
D03257
PubChem Substance
46507516
RxNav
224905
ChEMBL
CHEMBL1201585
Therapeutic Targets Database
DAP000391
PharmGKB
PA451743
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Trastuzumab
ATC Codes
L01XC03 — Trastuzumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (41 KB)
MSDS
Download (320 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedDiagnosticBreast Cancer1
0CompletedDiagnosticNeoplasms, Breast1
0CompletedTreatmentBreast Cancer1
0RecruitingDiagnosticBreast Cancer1
0RecruitingTreatmentBreast Cancer1
0WithdrawnTreatmentAdvanced Solid Tumors / Documented Her2 Overexpression / Neurologically Stable / Tumors Metastatic to Brain1
1Active Not RecruitingTreatmentAdvanced HER2-positive Breast Cancer / Brain Metastases From HER2 and Breast Cancer1
1Active Not RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Breast Cancer / Estrogen Receptor Positive / HER2/Neu Positive / One to five years postmenopausal / Premenopausal / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Refractory Breast Carcinoma / Refractory Hormone Receptor Positive Breast Carcinoma / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Tumors, Solid1
1Active Not RecruitingTreatmentAdvanced Solid Tumors / Colorectal Cancers / EGFR Positive Solid Tumor / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular,Carcinoma / HER2 Positive Breast Cancers / HER2 Positive Gastric Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Melanoma / Renal Cell Adenocarcinoma / Small Cell Lung Cancer (SCLC)1
1Active Not RecruitingTreatmentBreast Cancer4
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentHER2 Positive Metastatic Breast Cancers1
1Active Not RecruitingTreatmentMetastatic Breast Cancer / Recurrent Breast Cancer1
1Active Not RecruitingTreatmentNeoplasms, Breast1
1CompletedNot AvailableHealthy Volunteers5
1CompletedBasic ScienceHealthy Volunteers1
1CompletedDiagnosticHER2 Positive Carcinoma of Breast / Neoplasms, Breast / Secondary1
1CompletedOtherMetastatic Breast Cancer1
1CompletedScreeningHealthy Volunteers1
1CompletedTreatmentAbdominal wall neoplasm / Neoplasms, Breast / Neoplasms, Ovarian / Neoplasms, Pancreatic / Stomach Neoplasms1
1CompletedTreatmentAdvanced Adult Primary Liver Cancer / Advanced Gastric Cancer / Bone Metastases / Cancer, Anaplastic Thyroid / Carcinoma of the Appendix / Distal Urethral Cancer / Fallopian Tube Cancer / Gastrinoma / Glucagonoma / Hepatic Metastases / Inflammatory carcinoma of the breast / Insulinoma / Localized Unresectable Adult Primary Liver Cancer / Lung Cancer Metastatic / Male Breast Cancer / Malignant Pericardial Effusion / Malignant Pleural Effusions / Metastases to skin / Metastatic Bladder Cancer / Metastatic Colon Cancer / Metastatic Gastrointestinal Carcinoid Tumor / Metastatic Parathyroid Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Newly Diagnosed Carcinoma of Unknown Primary / Non-Small Cell Lung Cancer Recurrent / Occult Non-small Cell Lung Cancer / Pancreatic Polypeptide Tumor / Primary Peritoneal Cavity Cancer / Proximal Urethral Cancer / Pulmonary Carcinoid Tumor / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Adrenocortical Carcinoma / Recurrent Adult Primary Liver Cancer / Recurrent Anal Cancer / Recurrent Bladder Cancer / Recurrent Breast Cancer / Recurrent Carcinoma of Unknown Primary / Recurrent Cervical Cancer / Recurrent Colon Cancer / Recurrent Endometrial Carcinoma / Recurrent Esophageal Cancer / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Recurrent Gastric Cancer / Recurrent Gastrointestinal Carcinoid Tumor / Recurrent Islet Cell Carcinoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Ovarian Epithelial Cancer / Recurrent Pancreatic Cancer / Recurrent Parathyroid Cancer / Recurrent Prostate Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Small Intestine Cancer / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Thyroid Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Recurrent Vaginal Cancer / Recurrent Vulvar Cancer / Renal Cell Cancer, Recurrent / Small Intestine Adenocarcinoma / Somatostatinoma / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Adrenocortical Carcinoma / Stage III Bladder Cancer / Stage III Cervical Cancer / Stage III Colon Cancer / Stage III Endometrial Carcinoma / Stage III Esophageal Cancer / Stage III Follicular Thyroid Cancer / Stage III Gastric Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Ovarian Epithelial Cancer / Stage III Pancreatic Cancer / Stage III Papillary Thyroid Cancer / Stage III Prostate Cancer / Stage III Rectal Cancer / Stage III Renal Cell Cancer / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Vaginal Cancer / Stage III Vulvar Cancer / Stage IIIA Anal Cancer / Stage IIIA Breast Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Anal Cancer / Stage IIIB Breast Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Adrenocortical Carcinoma / Stage IV Anal Cancer / Stage IV Breast Cancer / Stage IV Endometrial Carcinoma / Stage IV Esophageal Cancer / Stage IV Follicular Thyroid Cancer / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Ovarian Epithelial Cancer / Stage IV Pancreatic Cancer / Stage IV Papillary Thyroid Cancer / Stage IV Prostate Cancer / Stage IV Rectal Cancer / Stage IV Renal Cell Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IVA Cervical Cancer / Stage IVA Vaginal Cancer / Stage IVB Cervical Cancer / Stage IVB Vaginal Cancer / Stage IVB Vulvar Cancer / Thyroid Gland Medullary Carcinoma / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer / Urethral Cancer Associated With Invasive Bladder Cancer / WDHA Syndrome1
1CompletedTreatmentAdvanced Cancers1
1CompletedTreatmentAdvanced HER2-positive Breast Cancer or Gastric Cancer1
1CompletedTreatmentAdvanced Solid Malignancies / Malignancies, Hematologic1
1CompletedTreatmentAdvanced Solid Tumors / Malignancies / Tumors1
1CompletedTreatmentBreast Cancer10
1CompletedTreatmentBreast Cancer / Locally Recurrent and Metastatic Breast Cancer / Malignancies / Metastases / Metastatic Cancers / Neoplasms, Breast / Oncology / Tumors / Tumors, Breast / Tumors, Solid1
1CompletedTreatmentBreast Cancer / Metastatic Breast Cancer, Locally Advanced Breast Cancer1
1CompletedTreatmentBreast Cancer / Metastatic Cancers1
1CompletedTreatmentBreast Cancer / Tumors Metastatic to Brain1
1CompletedTreatmentBreast Cancer / Tumors, Solid1
1CompletedTreatmentCarcinoma Breast Stage IV1
1CompletedTreatmentEarly Breast Cancer1
1CompletedTreatmentHER-2 Gene Amplification1
1CompletedTreatmentHER2 Positive Breast Cancers / Her2-negative Metastatic Breast Cancer / HER2-positive Metastatic Breast Cancer / Locally Advanced or Early Breast Cancer1
1CompletedTreatmentHER2 Positive Breast Cancers / Male Breast Cancer / Recurrent Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1CompletedTreatmentHER2 Positive Breast Cancers / Metastatic Breast Cancer1
1CompletedTreatmentHER2/Neu Positive / Invasive Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v71
1CompletedTreatmentHealthy Volunteers3
1CompletedTreatmentHealthy Volunteers / Neoplasms, Breast1
1CompletedTreatmentLocally Advanced Breast Cancer (LABC) / Metastatic Breast Cancer1
1CompletedTreatmentMale Breast Cancer / Non-Small Cell Lung Cancer Recurrent / Recurrent Breast Cancer / Recurrent Endometrial Carcinoma / Recurrent Gastric Cancer / Recurrent Ovarian Epithelial Cancer / Refractory Small cell lung cancer1
1CompletedTreatmentMalignancies1
1CompletedTreatmentMetastatic Breast Cancer4
1CompletedTreatmentMetastatic or Locally Advanced Solid Tumors1
1CompletedTreatmentNeoplasms, Breast6
1CompletedTreatmentNeoplasms, Breast / Stomach Neoplasms1
1CompletedTreatmentSolid Cancers1
1CompletedTreatmentTumors, Solid2
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific3
1Not Yet RecruitingBasic ScienceMetastatic Breast Cancer1
1Not Yet RecruitingTreatmentBreast Cancer1
1RecruitingTreatmentAdvanced or Metastatic Breast Cancer1
1RecruitingTreatmentAnatomic Stage IV Breast Cancer AJCC v8 / HER2 Positive Breast Carcinoma / Metastatic Breast Carcinoma / Prognostic Stage IV Breast Cancer AJCC v8 / Refractory Breast Carcinoma1
1RecruitingTreatmentBreast Cancer2
1RecruitingTreatmentBreast Cancer / Cancer of Head and Neck / Tumors, Solid1
1RecruitingTreatmentCancer, Advanced / Metastatic Cancers / NonHodgkin Lymphoma / Tumors, Solid1
1RecruitingTreatmentHER2 Positive Breast Cancers1
1RecruitingTreatmentHER2 Positive Breast Carcinoma / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1RecruitingTreatmentInflammatory carcinoma of the breast1
1RecruitingTreatmentMetastatic Breast Cancer1
1RecruitingTreatmentNeoplasms Metastasis1
1RecruitingTreatmentPosterior Fossa Ependymoma (PFEPN)1
1SuspendedTreatmentBreast Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Recurrent Non-Hodgkin Lymphoma / Recurrent Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Breast Cancer AJCC v6 and v71
1TerminatedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Advanced Gastric Cancer / HER2 Positive Breast Cancers / Male Breast Cancer / Recurrent Breast Cancer / Recurrent Esophageal Cancer / Recurrent Gastric Cancer / Stage IIIC Breast Cancer / Stage IIIC Esophageal Cancer / Stage IIIC Gastric Cancer / Stage IV Breast Cancer / Stage IV Esophageal Cancer1
1TerminatedTreatmentAdvanced Solid Tumors / Breast Cancer1
1TerminatedTreatmentAsymptomatic or Low Symptomatic Brain Metastasis in Breast Cancer / HER2 Positive Untreated Metastatic Breast Cancer1
1TerminatedTreatmentHER-2 protein overexpression / Tumors, Solid1
1TerminatedTreatmentHER2 Positive Breast Cancers / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
1TerminatedTreatmentNeoplasms1
1TerminatedTreatmentTumors, Solid1
1Unknown StatusTreatmentMetastatic Breast Cancer1
1WithdrawnTreatmentBreast Cancer1
1, 2Active Not RecruitingTreatmentBladder Urothelial Carcinoma / Stage I Bladder Cancer AJCC v6 and v7 / Stage II Bladder Cancer AJCC v6 and v7 / Stage III Bladder Cancer AJCC v6 and v71
1, 2Active Not RecruitingTreatmentBreast Cancer3
1, 2Active Not RecruitingTreatmentBreast Cancer / DCIS Breast Cancer1
1, 2Active Not RecruitingTreatmentCarcinoma, Breast / HER2 Positive Breast Cancers / Metastatic Breast Cancer1
1, 2Active Not RecruitingTreatmentHER2/Neu Positive / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
1, 2Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
1, 2Active Not RecruitingTreatmentMetastatic Breast Cancer1
1, 2Active Not RecruitingTreatmentNeoplasms, Breast1
1, 2CompletedTreatmentAdvanced Breast Cancer1
1, 2CompletedTreatmentBreast Cancer12
1, 2CompletedTreatmentBreast Cancer / Gliomas, Malignant / Lung Cancers / Melanoma / Tumors Metastatic to Brain1
1, 2CompletedTreatmentBreast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentBreast Cancer / Metastatic Breast Cancer1
1, 2CompletedTreatmentBreast Cancer / Neoplasms Metastasis1
1, 2CompletedTreatmentBreast Cancer / Neoplasms, Breast1
1, 2CompletedTreatmentCarcinomatous Meningitis / Metastatic Breast Cancer1
1, 2CompletedTreatmentEsophageal Carcinoma1
1, 2CompletedTreatmentHER-2 Positive Advanced Gastric Cancer1
1, 2CompletedTreatmentHER2 Positive Breast Cancers / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentMalignant Neoplasm of Pancreas1
1, 2CompletedTreatmentMetastatic Breast Cancer1
1, 2CompletedTreatmentMetastatic Breast Carcinoma1
1, 2CompletedTreatmentRecurrent Breast Cancer1
1, 2Not Yet RecruitingTreatmentAnatomic Stage IV Breast Cancer AJCC v8 / ERBB2 Gene Amplification / HER2 Positive Breast Carcinoma / Metastatic Breast Carcinoma / PIK3CA Gene Mutation / PTEN gene mutation1
1, 2Not Yet RecruitingTreatmentHER2 Positive Breast Cancers / Metastatic Breast Cancer / One to five years postmenopausal1
1, 2Not Yet RecruitingTreatmentMalignant Neoplasm of Stomach2
1, 2Not Yet RecruitingTreatmentMetastatic Lung Non-Small Cell Carcinoma / Refractory Lung Non-Small Cell Carcinoma / Stage IV Lung Cancer American Joint Committee on Cancer (AJCC) v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
1, 2RecruitingTreatmentBreast Cancer1
1, 2RecruitingTreatmentBreast Cancer / Breast cancer male / Breast Cancer, Male / HER2 Positive Breast Cancers / Malignant Neoplasm of Female Breast1
1, 2RecruitingTreatmentBreast Cancer / Cholangiocarcinomas / Endometrial Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Neoplasm of Stomach / Malignant Solid Tumours / MPN / MPN (Myeloproliferative Neoplasms) / Multiple Myeloma (MM) / Myeloproliferative Neoplasms / Neoplasms, Endometrial / NSCLC (Non-small Cell Lung Carcinoma) / Solid Tumors and Hematologic Malignancy / Stomach Neoplasms / Transitional Cell Carcinoma / Tumors, Solid / UC / UC (Urothelial Cancer) / Urothelial Cancer1
1, 2RecruitingTreatmentBreast Cancer / Combination Chemotherapy / HER2 Positive1
1, 2RecruitingTreatmentBreast Cancer / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentBreast Diseases / Neoplasms, Breast1
1, 2RecruitingTreatmentERBB2 Gene Amplification / Estrogen Receptor Positive / Inflammatory Breast Carcinoma / Malignant Neoplasm of Breast / Metastatic Breast Carcinoma / Progesterone Receptor Positive / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer AJCC v6 and v71
1, 2RecruitingTreatmentHER2 Positive Breast Cancers1
1, 2RecruitingTreatmentHER2 Positive Breast Carcinoma / Metastatic Breast Cancer1
1, 2RecruitingTreatmentMalignant Neoplasm of Breast / Neoplasms, Breast1
1, 2TerminatedTreatmentBreast Cancer5
1, 2TerminatedTreatmentBreast Cancer / Cancer, Advanced / Colorectal Cancers / Esophageal Cancers / Malignant Neoplasm of Stomach1
1, 2TerminatedTreatmentBreast Cancer / HER2 Positive Breast Cancers1
1, 2TerminatedTreatmentBreast Cancer / Metastatic Breast Cancer1
1, 2TerminatedTreatmentER-positive Breast Cancer / HER2 Positive Breast Cancers1
1, 2TerminatedTreatmentHER2 Positive Breast Cancers1
1, 2TerminatedTreatmentHER2 Positive Breast Cancers / Metastatic Breast Cancer1
1, 2TerminatedTreatmentMetastatic Breast Cancer1
1, 2TerminatedTreatmentNeoplasms1
1, 2TerminatedTreatmentStage IV (Metastatic) Breast Cancer1
1, 2WithdrawnTreatmentBrain and Central Nervous System Tumors / Breast Cancer / Cognitive/Functional Effects / Drug/Agent Toxicity by Tissue/Organ / Psychosocial Effects of Cancer and Its Treatment1
1, 2WithdrawnTreatmentBreast Cancer2
2Active Not RecruitingNot AvailableAdenocarcinoma of the Gastro-oesophageal Junction / Metastatic Gastric Cancers1
2Active Not RecruitingBasic ScienceBreast Cancer1
2Active Not RecruitingOtherBreast Cancer / Locally Advanced Malignant Neoplasm1
2Active Not RecruitingOtherNeoplasms, Breast1
2Active Not RecruitingPreventionBreast Cancer1
2Active Not RecruitingTreatmentAdenocarcinoma of the Stomach / Adenocarcinomas of the Gastroesophageal Junction1
2Active Not RecruitingTreatmentAdenocarcinomas1
2Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction1
2Active Not RecruitingTreatmentAdvanced Breast Cancer / HER2 Amplified / Human Epidermal Growth Factor Receptor 2 (HER2)1
2Active Not RecruitingTreatmentBreast Adenocarcinoma / HER2 Positive Breast Cancers / Inflammatory Breast Carcinoma / Recurrent Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2Active Not RecruitingTreatmentBreast Cancer13
2Active Not RecruitingTreatmentBreast Cancer / Breast Cancer Stage II / Breast Cancer Stage III / HER2 Positive Breast Cancers / Malignant Neoplasm of Female Breast1
2Active Not RecruitingTreatmentBreast Cancer / Carcinoma of the Breast1
2Active Not RecruitingTreatmentBreast Cancer / HER2 Negative Breast Cancer / HER2 Positive Breast Cancers / HER2-Negative Breast Cancer / Recurrent Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingTreatmentBreast Cancer / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentColorectal Cancers1
2Active Not RecruitingTreatmentElderly Metastatic Breast Cancer Population1
2Active Not RecruitingTreatmentEndometrial Cancer1
2Active Not RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2Active Not RecruitingTreatmentGeriatric Health Services / HER2/Neu Positive / Neoplasms, Breast1
2Active Not RecruitingTreatmentHER2 Positive Breast Cancers2
2Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Hormone Receptor Positive Tumor1
2Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
2Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Left Ventricular Function Systolic Dysfunction1
2Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Recurrent Breast Cancer / Stage IV Breast Cancer1
2Active Not RecruitingTreatmentHER2 Positive Breast Carcinoma / Stage I Breast Cancer AJCC v7 / Stage IA Breast Cancer / Stage IA Breast Cancer AJCC v7 / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage II Breast Cancer AJCC v6 and v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentHER2-Positive Early Breast Cancer1
2Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
2Active Not RecruitingTreatmentMalignant Tumor of the Breast / Neoplasms, Breast1
2Active Not RecruitingTreatmentMetastatic Breast Cancer3
2Active Not RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
2Active Not RecruitingTreatmentMetastatic HER2-Positive Breast Cancer1
2Active Not RecruitingTreatmentNeoplasms, Breast3
2Active Not RecruitingTreatmentNeoplasms, Esophageal / Stomach Neoplasms1
2Active Not RecruitingTreatmentReccurent/Metastatic Solid Tumor Disease1
2CompletedBasic ScienceStage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2CompletedDiagnosticMetastatic Breast Cancer1
2CompletedPreventionBreast Cancer1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2CompletedTreatmentAdvanced Breast Cancer / Breast Cancer1
2CompletedTreatmentAdvanced Breast Cancer / Breast Cancer / Metastatic Breast Cancer1
2CompletedTreatmentAdvanced HER2-positive Breast Cancer1
2CompletedTreatmentBreast Cancer80
2CompletedTreatmentBreast Cancer / Cancer of the Breast / Neoplasms, Breast1
2CompletedTreatmentBreast Cancer / Cardiac Toxicity1
2CompletedTreatmentBreast Cancer / Circulating Tumor Cells / Human Epidermal Growth Factor 2 Negative Carcinoma of Breast1
2CompletedTreatmentBreast Cancer / HER2 Positive1
2CompletedTreatmentBreast Cancer / Inflammatory carcinoma of the breast / Locally Advanced Breast Cancer (LABC)1
2CompletedTreatmentBreast Cancer / Metastatic Breast Cancer1
2CompletedTreatmentBreast Cancer / Metastatic Breast Cancer / Progressive Breast Cancer1
2CompletedTreatmentBreast Cancer / Metastatic Breast Cancer / Triple Negative Breast Cancer (TNBC) / Tumors Metastatic to Brain1
2CompletedTreatmentBreast Cancer / Neoplasms, Breast2
2CompletedTreatmentBreast Cancer / Stage II Breast Cancer / Stage III Breast Cancer1
2CompletedTreatmentBreast Cancer / Tumors Metastatic to Brain1
2CompletedTreatmentCarcinoma Breast Stage IV1
2CompletedTreatmentCarcinoma, Breast1
2CompletedTreatmentColorectal Cancers1
2CompletedTreatmentEndometrial Adenocarcinomas / ERBB2 Gene Amplification / Recurrent Endometrial Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage III Endometrial Carcinoma / Stage III Uterine Corpus Cancer AJCC v7 / Stage IV Endometrial Carcinoma / Stage IV Uterine Corpus Cancer AJCC v71
2CompletedTreatmentERBB2 Gene Amplification / Neoplasms Metastasis / Stomach Neoplasms1
2CompletedTreatmentEarly Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer1
2CompletedTreatmentEndocrine Sensitive HER2+/HR+ Breast Cancer1
2CompletedTreatmentEstrogen Receptor Positive Breast Cancer / Estrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / HER2 Positive Breast Cancers / Progesterone Receptor Positive Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentEstrogen Receptor Positive Breast Cancer / Estrogen Receptor-Positive Breast Cancer / HER2 Positive Breast Cancers / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2CompletedTreatmentHER 2 Positive Advanced Gastric Cancer1
2CompletedTreatmentHER-2 Positive Metastatic Breast Cancer1
2CompletedTreatmentHER2 Positive Breast Cancers4
2CompletedTreatmentHER2 Positive Breast Cancers / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer2
2CompletedTreatmentHER2 Positive Breast Cancers / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentHER2-Positive Early Stage Breast Cancer1
2CompletedTreatmentHER2-positive Newly Diagnosed, Primary Breast Cancer / HER2-positive, Newly Diagnosed, Primary Breast Cancer, Neoadjuvant Therapy, Trastuzumab1
2CompletedTreatmentHer-2 Positive Gastric Cancer / Metastatic or Recurrent Gastric Adenocarcinoma1
2CompletedTreatmentLung Cancers2
2CompletedTreatmentMale Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentMalignant Neoplasm of Pancreas / Neoplasms, Pancreatic1
2CompletedTreatmentMalignant Neoplasm of Stomach3
2CompletedTreatmentMetastatic Bladder Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Squamous Cell Carcinoma of the Bladder / Transitional Cell Carcinoma of the Bladder1
2CompletedTreatmentMetastatic Bladder Cancer / Recurrent Bladder Cancer / Transitional Cell Carcinoma of the Bladder1
2CompletedTreatmentMetastatic Bone Sarcomas1
2CompletedTreatmentMetastatic Breast Cancer6
2CompletedTreatmentMetastatic Breast Cancer Considered HER2 Negative on Primary Tumor / Metastatic Breast Cancer, HER2 Negative Primary Tumor / Patients With Metastatic Breast Cancer Considered HER2 Negative on Primary Tumor1
2CompletedTreatmentMetastatic Cancers1
2CompletedTreatmentNeoplasms, Breast14
2CompletedTreatmentNon-Small Cell Lung Cancer Recurrent / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentProstate Cancer2
2CompletedTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentSarcomas2
2CompletedTreatmentStage IV Gastric Cancer With Metastasis1
2CompletedTreatmentUnilateral HER2 Positive Breast Cancer1
2CompletedTreatmentUrinary Tract Cancers1
2CompletedTreatmentUrologic Neoplasms1
2Not Yet RecruitingTreatmentAdenocarcinoma Of Esophagus / Gastric Adenocarcinoma1
2Not Yet RecruitingTreatmentAdvanced Gastric Cancer1
2Not Yet RecruitingTreatmentAnatomic Stage I Breast Cancer AJCC v8 / Anatomic Stage IA Breast Cancer AJCC v8 / Anatomic Stage IB Breast Cancer AJCC v8 / Anatomic Stage II Breast Cancer AJCC v8 / Anatomic Stage IIA Breast Cancer AJCC v8 / Anatomic Stage IIB Breast Cancer AJCC v8 / Anatomic Stage III Breast Cancer AJCC v8 / Anatomic Stage IIIA Breast Cancer AJCC v8 / Anatomic Stage IIIB Breast Cancer AJCC v8 / Anatomic Stage IIIC Breast Cancer AJCC v8 / Prognostic Stage I Breast Cancer AJCC v8 / Prognostic Stage IA Breast Cancer AJCC v8 / Prognostic Stage IB Breast Cancer AJCC v8 / Prognostic Stage II Breast Cancer AJCC v8 / Prognostic Stage IIA Breast Cancer AJCC v8 / Prognostic Stage IIB Breast Cancer AJCC v8 / Prognostic Stage III Breast Cancer AJCC v8 / Prognostic Stage IIIA Breast Cancer AJCC v8 / Prognostic Stage IIIB Breast Cancer AJCC v8 / Prognostic Stage IIIC Breast Cancer AJCC v81
2Not Yet RecruitingTreatmentBreast Cancer3
2Not Yet RecruitingTreatmentBreast Cancer / ER-positive Breast Cancer / HER2 Positive Breast Cancers1
2Not Yet RecruitingTreatmentBreast Cancer / Tumors Metastatic to Brain1
2Not Yet RecruitingTreatmentBreast Diseases / HER2 Positive Breast Cancers / Hormone Receptor Positive Malignant Neoplasm of Breast / Hormone Receptor Positive Tumor / Malignant Neoplasm of Female Breast / Metastatic Breast Cancer2
2Not Yet RecruitingTreatmentEndometrial Cancer1
2Not Yet RecruitingTreatmentGastric or Gastroesophageal Junction(GEJ) Adenocarcinoma1
2Not Yet RecruitingTreatmentHER-2 Gene Amplification / HER-2 protein overexpression1
2Not Yet RecruitingTreatmentHER2 Positive Breast Cancers1
2Not Yet RecruitingTreatmentHER2 Positive Breast Cancers / Metastatic Breast Cancer1
2Not Yet RecruitingTreatmentInvasive Breast Cancer1
2Not Yet RecruitingTreatmentMalignancies / Neoplasms / Tumors1
2Not Yet RecruitingTreatmentMalignant Neoplasm of Stomach1
2Not Yet RecruitingTreatmentMammary Cancer1
2Not Yet RecruitingTreatmentMetastatic Breast Cancer1
2Not Yet RecruitingTreatmentSalivary Duct Carcinoma1
2RecruitingOtherBreast Cancer1
2RecruitingTreatmentAdenocarcinoma Of Esophagus / Gastric Adenocarcinoma / HER-2 Gene Amplification / Metastasis1
2RecruitingTreatmentAdenocarcinoma of the Gastro-oesophageal Junction / Adenocarcinoma of the Oesophagus / Adenocarcinoma of the Stomach1
2RecruitingTreatmentAdvanced Breast Cancer1
2RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Esophageal Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Uterine Neoplasm / Melanoma / Ovarian Carcinoma / Plasma Cell Myeloma / Prostate Cancer / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Thyroid Gland Carcinoma / Uterine Corpus Cancer1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)2
2RecruitingTreatmentAnatomic Stage II Breast Cancer AJCC v8 / Anatomic Stage IIA Breast Cancer AJCC v8 / Anatomic Stage IIB Breast Cancer AJCC v8 / Anatomic Stage IIIA Breast Cancer AJCC v8 / Invasive Breast Carcinoma / Prognostic Stage II Breast Cancer AJCC v8 / Prognostic Stage IIA Breast Cancer AJCC v8 / Prognostic Stage IIB Breast Cancer AJCC v8 / Prognostic Stage IIIA Breast Cancer AJCC v81
2RecruitingTreatmentBiliary Cancer / Cancer, Bladder / Neoplasms / Salivary Cancer / Tumors, Solid1
2RecruitingTreatmentBiliary Tract Cancer / Cholangiocarcinomas / HER-2 Gene Amplification / HER-2 protein overexpression1
2RecruitingTreatmentBiliary Tract Cancer / Colorectal Cancers / Esophageal Squamous Cell Carcinoma (ESCC) / HER2 / Targeted Therapy1
2RecruitingTreatmentBreast Adenocarcinoma / Stage II Breast Cancer AJCC v6 and v7 / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer AJCC v6 and v7 / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v71
2RecruitingTreatmentBreast Cancer9
2RecruitingTreatmentBreast Cancer / Cancer of the Breast / Carcinoma, Breast1
2RecruitingTreatmentBreast Cancer / Chest Wall Disease1
2RecruitingTreatmentBreast Cancer / Estrogen Receptor Positive Tumor / HER2 Positive Breast Cancers1
2RecruitingTreatmentBreast Cancer / HER2 Positive Breast Cancers1
2RecruitingTreatmentBreast Cancer / HER2 Positive Breast Cancers / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentBreast Cancer / Hemangiosarcoma / Neoplasms, Breast / Tumors, Breast1
2RecruitingTreatmentBreast Cancer / Neoadjuvant Chemotherapy1
2RecruitingTreatmentCancer of Unknown Primary Site1
2RecruitingTreatmentCancer of the Gallbladder / Cholangiocarcinoma of the Extrahepatic Bile Duct1
2RecruitingTreatmentCarcinoma, Breast1
2RecruitingTreatmentCentral Nervous System Metastases / HER2-positive Metastatic Breast Cancer1
2RecruitingTreatmentColon Adenocarcinoma / ERBB2 Gene Amplification / Rectal Adenocarcinoma / Recurrent Colon Carcinoma / Recurrent Rectal Carcinoma / Stage III Colon Cancer AJCC v7 / Stage III Rectal Cancer AJCC v7 / Stage IIIA Colon Cancer AJCC v7 / Stage IIIA Rectal Cancer AJCC v7 / Stage IIIB Colon Cancer AJCC v7 / Stage IIIB Rectal Cancer AJCC v7 / Stage IIIC Colon Cancer AJCC v7 / Stage IIIC Rectal Cancer AJCC v7 / Stage IV Colon Cancer AJCC v7 / Stage IV Rectal Cancer AJCC v7 / Stage IVA Colon Cancer AJCC v7 / Stage IVA Rectal Cancer AJCC v7 / Stage IVB Colon Cancer AJCC v7 / Stage IVB Rectal Cancer AJCC v71
2RecruitingTreatmentEarly Breast Cancer / HER2 Positive Breast Cancers1
2RecruitingTreatmentEpidermal Growth Factor Receptor (EGFR) Protein Overexpression / Malignant Neoplasm of Cardio-esophageal Junction of Stomach / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / Estrogen Receptor Positive Breast Cancer / Estrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / HER2 Negative Breast Cancer / HER2 Positive Breast Cancers / HER2-Negative Breast Cancer / HER2/Neu Negative / HER2/Neu Positive / Invasive Breast Carcinoma / Progesterone Receptor Negative / Progesterone Receptor Positive / Progesterone Receptor Positive Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC) / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentHER2 Gene Mutation / Locally Advanced Non-Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic / Non Small Cell Lung Cancer Stage III1
2RecruitingTreatmentHER2 Negative Breast Cancer / HER2-Negative Breast Cancer1
2RecruitingTreatmentHER2 Positive Breast Cancers5
2RecruitingTreatmentHER2 Positive Breast Cancers / Metastatic Breast Cancer1
2RecruitingTreatmentHER2 Positive Breast Cancers / Operable Breast Cancer1
2RecruitingTreatmentHER2 Positive Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2RecruitingTreatmentHER2 Positive Breast Carcinoma / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2RecruitingTreatmentHer-2 Positive Gastric Cancer / Metastatic Cancers1
2RecruitingTreatmentLeptomeningeal Disease / Metastatic Breast Cancer1
2RecruitingTreatmentLocally Advanced Breast Cancer (LABC)1
2RecruitingTreatmentMalignancies / Neoplasms / Tumors1
2RecruitingTreatmentMalignant Neoplasm of Stomach2
2RecruitingTreatmentMetastatic Breast Cancer4
2RecruitingTreatmentMetastatic Colorectal Adenocarcinoma1
2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
2RecruitingTreatmentNeoplasms Metastasis1
2RecruitingTreatmentNeoplasms, Breast3
2RecruitingTreatmentPancreatic Adenocarcinoma Metastatic1
2RecruitingTreatmentRare Tumor / Refractory Tumors1
2RecruitingTreatmentRefractory Pediatric AML / Refractory Pediatric Solid Tumors / Relapsed Pediatric AML / Relapsed Pediatric Solid Tumors1
2RecruitingTreatmentSolid Tumors Harboring Somatic HER2 or EGFR Exon 18 Mutations1
2TerminatedTreatmentAdenocarcinoma of the Extrahepatic Bile Duct / Adenocarcinoma of the Gallbladder / Neoplasms, Malignant / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer1
2TerminatedTreatmentAdvanced Gastric Cancer1
2TerminatedTreatmentBreast Cancer14
2TerminatedTreatmentBreast Cancer / Cancer of the Breast / HER2 Positive Breast Cancers / Metastatic Breast Cancer1
2TerminatedTreatmentBreast Cancer / Estrogen Receptor Negative Neoplasm / HER2 Positive Breast Cancers1
2TerminatedTreatmentBreast Cancer / Metastatic Breast Cancer1
2TerminatedTreatmentBreast Cancer / Neoplasms Metastasis1
2TerminatedTreatmentBreast Carcinoma Metastatic in the Brain / Estrogen Receptor Negative / HER2/Neu Negative / HER2/Neu Positive / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
2TerminatedTreatmentCarcinoma, Ductal, Breast1
2TerminatedTreatmentColorectal Cancers1
2TerminatedTreatmentDistal Urethral Cancer / Metastatic Bladder Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Proximal Urethral Cancer / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Transitional Cell Carcinoma of the Bladder / Urethral Cancer Associated With Invasive Bladder Cancer1
2TerminatedTreatmentEsophagus Cancer / Gastroesophageal Junction Cancer / HER-2 Gene Amplification / Malignant Neoplasm of Stomach1
2TerminatedTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2TerminatedTreatmentHER-2 Positive Metastatic Breast Cancer1
2TerminatedTreatmentHER2 Positive Breast Cancers / Metastatic Breast Cancer1
2TerminatedTreatmentHER2 Positive Breast Cancers / Recurrent Breast Cancer / Stage IV Breast Cancer1
2TerminatedTreatmentHigh-grade Salivary Gland Mucoepidermoid Carcinoma / Recurrent Salivary Gland Cancer / Salivary Gland Acinic Cell Tumor / Salivary Gland Adenocarcinoma / Salivary Gland Poorly Differentiated Carcinoma / Stage IVA Salivary Gland Cancer / Stage IVB Salivary Gland Cancer / Stage IVC Salivary Gland Cancer1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentMalignant Neoplasm of Stomach1
2TerminatedTreatmentMetastatic Breast Cancer2
2TerminatedTreatmentNeoplasms, Breast1
2TerminatedTreatmentOvarian Cancer1
2TerminatedTreatmentRelapsed/Refractory Leukemia1
2TerminatedTreatmentUrinary Tract Cancers1
2Unknown StatusTreatmentBreast Cancer7
2Unknown StatusTreatmentBreast Cancer / Breast Diseases / Neoplasms / Neoplasms by Site1
2Unknown StatusTreatmentHER2 Positive Breast Cancers1
2Unknown StatusTreatmentHead and Neck Carcinoma1
2Unknown StatusTreatmentHepatic Metastases / Metastatic Breast Cancer2
2Unknown StatusTreatmentInfiltrating Duct and Lobular Carcinoma In Situ / Inflammatory Breast Carcinoma / Invasive Lobular Breast Carcinoma1
2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
2Unknown StatusTreatmentMetastatic Breast Cancer2
2WithdrawnDiagnosticBreast Cancer / Lung Cancers / Neoplasms, Breast / Neoplasms, Lung1
2WithdrawnTreatmentBreast Cancer5
2WithdrawnTreatmentBreast Cancer / Breast Cancer Stage II / Breast Cancer Stage III1
2WithdrawnTreatmentMalignant Neoplasm of Stomach1
2WithdrawnTreatmentMetastatic Breast Cancer1
2WithdrawnTreatmentNeoplasms, Breast3
2WithdrawnTreatmentPaget's Disease of the Vulva1
2, 3Active Not RecruitingTreatmentGastric Adenocarcinoma1
2, 3Active Not RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
2, 3Not Yet RecruitingTreatmentBreast Cancer1
2, 3RecruitingTreatmentEarly-Stage Breast Carcinoma / HER2 Positive Breast Cancers1
2, 3RecruitingTreatmentGastroesophageal Junction Cancer / HER2 Positive Gastric Cancer / HER2-positive Gastric Cancer / Malignant Neoplasm of Stomach1
2, 3RecruitingTreatmentHER2 Positive Breast Cancers1
2, 3TerminatedTreatmentBreast Cancer / HER2 Positive Breast Cancers1
2, 3TerminatedTreatmentMetastatic Breast Cancer1
3Active Not RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Stage IB Esophageal Cancer AJCC v7 / Stage IIA Esophageal Cancer AJCC v7 / Stage IIB Esophageal Cancer AJCC v7 / Stage IIIA Esophageal Cancer AJCC v7 / Stage IIIB Esophageal Cancer AJCC v71
3Active Not RecruitingTreatmentBreast Adenocarcinoma / HER2 Positive Breast Carcinoma / Stage IA Breast Cancer / Stage IA Breast Cancer AJCC v7 / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v71
3Active Not RecruitingTreatmentBreast Cancer12
3Active Not RecruitingTreatmentBreast Cancer / HER2 Positive1
3Active Not RecruitingTreatmentBreast Cancer / Neoplasms, Breast1
3Active Not RecruitingTreatmentDuctal Breast Carcinoma In Situ1
3Active Not RecruitingTreatmentEarly Breast Cancer1
3Active Not RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Positive / Progesterone Receptor Negative / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Stage IA Breast Cancer / Stage IA Breast Cancer AJCC v7 / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v71
3Active Not RecruitingTreatmentHER2 Positive Breast Cancers1
3Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Neoplasms, Metastatic1
3Active Not RecruitingTreatmentHER2-positive Locally Advanced or Metastatic Breast Cancer1
3Active Not RecruitingTreatmentHER2/Neu Positive / Stage IB Breast Cancer AJCC v7 / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v71
3Active Not RecruitingTreatmentInvasive Breast Cancer1
3Active Not RecruitingTreatmentMale Breast Carcinoma / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v71
3Active Not RecruitingTreatmentMetastatic Breast Cancer3
3Active Not RecruitingTreatmentNeoplasms, Breast2
3CompletedPreventionBreast Cancer1
3CompletedTreatmentBreast Cancer29
3CompletedTreatmentBreast Cancer / Neoplasms, Breast2
3CompletedTreatmentBreast Cancer / Stage IV Breast Cancer1
3CompletedTreatmentEarly Breast Cancer1
3CompletedTreatmentHER2 Negative Breast Cancer / HER2 Positive Breast Cancers / HER2-Negative Breast Cancer / Recurrent Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
3CompletedTreatmentHER2 Positive Breast Cancers / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
3CompletedTreatmentHER2 Positive Early or Locally Advanced Breast Cancer1
3CompletedTreatmentHER2-positive Carcinoma of Breast1
3CompletedTreatmentHER2-positive Metastatic Breast Cancer / Human Epithelial Receptor (HER)-2 Positive Breast Cancer1
3CompletedTreatmentHER2/Neu Over-expressing Locally Advanced Breast Cancer / Metastatic Breast Cancer1
3CompletedTreatmentHER2/Neu Positive / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
3CompletedTreatmentMalignancies1
3CompletedTreatmentMalignant Neoplasm of Stomach2
3CompletedTreatmentMetastatic Breast Cancer2
3CompletedTreatmentNeoplasms, Breast6
3CompletedTreatmentTumors Metastatic to Brain1
3Enrolling by InvitationTreatmentBreast Cancer / Early Breast Cancer / HER2 Positive Breast Cancers / Neoplasms, Breast / Stage II Breast Cancer / Stage IIIA Breast Cancer1
3Not Yet RecruitingTreatmentAdvanced HER2+Breast Cancer1
3Not Yet RecruitingTreatmentHER2 Positive Breast Cancers1
3Not Yet RecruitingTreatmentMetastatic Breast Cancer1
3RecruitingOtherInvasive Breast Cancer1
3RecruitingOtherNeoplasms, Breast1
3RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Neoplasm, Gastric1
3RecruitingTreatmentBreast Adenocarcinoma / Metastatic Breast Adenocarcinoma / Recurrent Breast Carcinoma / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Breast Carcinoma1
3RecruitingTreatmentBreast Cancer6
3RecruitingTreatmentBreast Cancer / Breast Cancer Model / Effects of Chemotherapy1
3RecruitingTreatmentBreast Cancer / HER2 Positive Breast Cancers / Neoplasms, Breast / Stage II Breast Cancer / Stage IIIA Breast Cancer1
3RecruitingTreatmentEarly Breast Cancer / HER2 Positive Breast Cancers1
3RecruitingTreatmentEstrogen Receptor Positive Breast Cancer / HER2 Positive Breast Cancers1
3RecruitingTreatmentHER2 Positive Breast Cancers1
3RecruitingTreatmentHER2-Positive Early Breast Cancer2
3RecruitingTreatmentHER2-positive Metastatic Breast Cancer1
3RecruitingTreatmentMalignant Neoplasm of Breast1
3RecruitingTreatmentMalignant Neoplasm of Stomach1
3RecruitingTreatmentMetastatic Breast Cancer2
3RecruitingTreatmentTumors, Solid1
3TerminatedTreatmentBreast Cancer2
3TerminatedTreatmentBreast Cancer / Metastasis / Sur-expressing Her2-neu1
3TerminatedTreatmentCarcinoma, Breast / HER2/Neu Positive / Male Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
3TerminatedTreatmentCardiac Toxicity / Inflammatory carcinoma of the breast / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IV Breast Cancer1
3TerminatedTreatmentMalignancies1
3TerminatedTreatmentMalignant Neoplasm of Stomach1
3Unknown StatusDiagnosticBreast Cancer1
3Unknown StatusTreatmentBreast Cancer4
3Unknown StatusTreatmentMetastatic or Locally Advanced Breast Cancer1
3WithdrawnOtherAdvanced Breast Cancer / HER2 Positive Breast Cancers1
3WithdrawnTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
4Active Not RecruitingTreatmentBreast Cancer1
4CompletedDiagnosticBreast Cancer1
4CompletedTreatmentBreast Cancer3
4RecruitingTreatmentHer-2 Positive Gastric Cancer / Liver Metastasis1
4TerminatedTreatmentMalignant Neoplasm of Stomach1
4TerminatedTreatmentMetastatic Breast Cancer1
Not AvailableActive Not RecruitingDiagnosticBone Metastases / Hepatic Metastases / HER2 Positive Breast Cancers / Lung Cancer Metastatic / Recurrent Breast Cancer / Soft Tissue Metastases / Stage IV Breast Cancer1
Not AvailableActive Not RecruitingTreatmentStage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
Not AvailableApproved for MarketingNot AvailableHER2 Positive Breast Cancers1
Not AvailableAvailableNot AvailableHER2 Positive Breast Cancers / Novel Coronavirus Infectious Disease (COVID-19)1
Not AvailableCompletedNot AvailableBreast Cancer5
Not AvailableCompletedNot AvailableBreast Cancer / Cardiac Toxicity1
Not AvailableCompletedNot AvailableBreast Cancer / Cardiac Toxicity / Cardiovascular Complications1
Not AvailableCompletedNot AvailableBreast Cancer / Chemotherapeutic Agent Toxicity / Cognitive/Functional Effects / Fatigue / Long-Term Effects Secondary to Cancer Therapy in Adults / Neurologic toxicity / Psychosocial Effects of Cancer and Its Treatment1
Not AvailableCompletedNot AvailableBreast Cancer / Metastatic Cancers1
Not AvailableCompletedNot AvailableBreast Cancer / Neoplasms, Breast1
Not AvailableCompletedNot AvailableBreast Cancer / Pregnancy1
Not AvailableCompletedNot AvailableGastric Adenocarcinoma1
Not AvailableCompletedNot AvailableGastric Cancer, Gastroesophageal Junction Cancer1
Not AvailableCompletedNot AvailableMalignancies1
Not AvailableCompletedNot AvailableMalignant Neoplasm of Stomach1
Not AvailableCompletedTreatmentBreast Cancer3
Not AvailableCompletedTreatmentBreast Cancer / Lung Cancers / Ovarian Cancer / Prostate Cancer / Sarcomas / Unspecified Adult Solid Tumor, Protocol Specific1
Not AvailableCompletedTreatmentDuctal Carcinoma In Situ1
Not AvailableCompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Breast Cancer / Sarcomas / Tumors, Solid1
Not AvailableEnrolling by InvitationNot AvailableHER2 Positive Breast Cancers1
Not AvailableEnrolling by InvitationNot AvailableNeoplasms, Breast1
Not AvailableNot Yet RecruitingNot AvailableObservational / Prospective1
Not AvailableNot Yet RecruitingTreatmentHER2 Positive Breast Cancers2
Not AvailableRecruitingNot AvailableBreast Cancer3
Not AvailableRecruitingNot AvailableCancer, Treatment-Related / Cardiovascular Morbidity / Toxicity Due to Chemotherapy1
Not AvailableRecruitingNot AvailableChemotherapy Effect / Malignant Neoplasm of Stomach / Predictive Cancer Model1
Not AvailableRecruitingNot AvailableColorectal Cancers1
Not AvailableRecruitingNot AvailableHER2 Positive Breast Cancers1
Not AvailableRecruitingTreatmentAdenocarcinomas1
Not AvailableRecruitingTreatmentBreast Cancer Nos Premenopausal1
Not AvailableRecruitingTreatmentBreast Cancer / Breast Diseases / Neoplasms, Breast1
Not AvailableRecruitingTreatmentColorectal Cancers1
Not AvailableRecruitingTreatmentGastroesophageal Cancer (GC) / Malignant Neoplasm of Stomach1
Not AvailableSuspendedNot AvailableBreast Cancer1
Not AvailableTerminatedNot AvailableBreast Cancer1
Not AvailableUnknown StatusDiagnosticBreast Cancer / Metastatic Cancers1
Not AvailableWithdrawnNot AvailableLocal Recurrence of Malignant Tumor of Breast1
Not AvailableWithdrawnTreatmentBreast Cancer / Elderly Patients Diagnosed With Breast Cancer / HER2 Positive Breast Cancers1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • DSM Corp.
  • F Hoffmann-La Roche Ltd.
  • Genentech Inc.
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous150 mg
Injection, powder, lyophilized, for solutionIntravenous150 mg/7.4mL
Injection, solutionSubcutaneous600 mg
Powder, for solutionIntravenous440 mg
Injection, solutionSubcutaneous
SolutionSubcutaneous
Injection, powder, lyophilized, for solutionIntravenous150 mg/20mL
Kit; powder, for solutionIntravenous440 mg
Injection, powder, lyophilized, for solutionIntravenous150 mg/7.15mL
Injection, powder, lyophilized, for solutionIntravenous420 mg/20mL
Kit; powder, for solutionIntravenous420 mg
Powder, for solutionIntravenous
Powder, for solutionIntravenous150 mg
Injection, powder, lyophilized, for solutionIntravenous150 mg/1
KitIntravenous420 mg/1
Kit; powder, for solution; solutionIntravenous
Powder, for solutionIntravenous
Prices
Unit descriptionCostUnit
Herceptin 440 mg Solution Vial3581.2USD vial
Herceptin 440 mg vial3443.46USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2103059No2005-03-222012-06-15Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.415Not Available
isoelectric point8.45Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Transmembrane signaling receptor activity
Specific Function
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, alt...
Gene Name
ERBB2
Uniprot ID
P04626
Uniprot Name
Receptor tyrosine-protein kinase erbB-2
Molecular Weight
137909.27 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Leveque D, Gigou L, Bergerat JP: Clinical pharmacology of trastuzumab. Curr Clin Pharmacol. 2008 Jan;3(1):51-5. [PubMed:18690878]
  3. Lin A, Rugo HS: The role of trastuzumab in early stage breast cancer: current data and treatment recommendations. Curr Treat Options Oncol. 2007 Feb;8(1):47-60. [PubMed:17660958]
  4. Treish I, Schwartz R, Lindley C: Pharmacology and therapeutic use of trastuzumab in breast cancer. Am J Health Syst Pharm. 2000 Nov 15;57(22):2063-76; quiz 2077-9. [PubMed:11098307]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Ubiquitin protein ligase binding
Specific Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TG...
Gene Name
EGFR
Uniprot ID
P00533
Uniprot Name
Epidermal growth factor receptor
Molecular Weight
134276.185 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Curnow RT: Clinical experience with CD64-directed immunotherapy. An overview. Cancer Immunol Immunother. 1997 Nov-Dec;45(3-4):210-5. [PubMed:9435876]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Bowles JA, Weiner GJ: CD16 polymorphisms and NK activation induced by monoclonal antibody-coated target cells. J Immunol Methods. 2005 Sep;304(1-2):88-99. [PubMed:16109421]
  2. Shahied LS, Tang Y, Alpaugh RK, Somer R, Greenspon D, Weiner LM: Bispecific minibodies targeting HER2/neu and CD16 exhibit improved tumor lysis when placed in a divalent tumor antigen binding format. J Biol Chem. 2004 Dec 24;279(52):53907-14. Epub 2004 Oct 7. [PubMed:15471859]
  3. Kubo M, Morisaki T, Kuroki H, Tasaki A, Yamanaka N, Matsumoto K, Nakamura K, Onishi H, Baba E, Katano M: Combination of adoptive immunotherapy with Herceptin for patients with HER2-expressing breast cancer. Anticancer Res. 2003 Nov-Dec;23(6a):4443-9. [PubMed:14666732]
  4. Yamaguchi Y, Hironaka K, Okawaki M, Okita R, Matsuura K, Ohshita A, Toge T: HER2-specific cytotoxic activity of lymphokine-activated killer cells in the presence of trastuzumab. Anticancer Res. 2005 Mar-Apr;25(2A):827-32. [PubMed:15868915]
  5. Xie Z, Guo N, Yu M, Hu M, Shen B: A new format of bispecific antibody: highly efficient heterodimerization, expression and tumor cell lysis. J Immunol Methods. 2005 Jan;296(1-2):95-101. Epub 2004 Nov 19. [PubMed:15680154]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Suzuki E, Niwa R, Saji S, Muta M, Hirose M, Iida S, Shiotsu Y, Satoh M, Shitara K, Kondo M, Toi M: A nonfucosylated anti-HER2 antibody augments antibody-dependent cellular cytotoxicity in breast cancer patients. Clin Cancer Res. 2007 Mar 15;13(6):1875-82. [PubMed:17363544]

Drug created on June 13, 2005 07:24 / Updated on May 30, 2020 00:21

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates