Sodium/bile acid cotransporter

Details

Name
Sodium/bile acid cotransporter
Synonyms
  • Cell growth-inhibiting gene 29 protein
  • Na(+)/bile acid cotransporter
  • Na(+)/taurocholate transport protein
  • NTCP
  • Sodium/taurocholate cotransporting polypeptide
  • Solute carrier family 10 member 1
Gene Name
SLC10A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017172|Sodium/bile acid cotransporter
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKG
LAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSI
VMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKR
PQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL
SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLL
IAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Number of residues
349
Molecular Weight
38118.64
Theoretical pI
8.94
GO Classification
Functions
bile acid / virus receptor activity
Processes
bile acid and bile salt transport / bile acid metabolic process / small molecule metabolic process / transport
Components
basolateral plasma membrane / integral component of plasma membrane / plasma membrane
General Function
Virus receptor activity
Specific Function
The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.(Microbial infection) Acts as a receptor for hepatitis B virus.
Pfam Domain Function
Transmembrane Regions
25-45 60-80 91-111 120-140 156-176 191-211 220-240 283-303
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0017173|Sodium/bile acid cotransporter (SLC10A1)
ATGGAGGCCCACAACGCGTCTGCCCCATTCAACTTCACCCTGCCACCCAACTTTGGCAAG
CGCCCCACAGACCTGGCACTGAGCGTCATCCTGGTGTTCATGTTGTTCTTCATCATGCTC
TCGCTGGGCTGCACCATGGAGTTCAGCAAGATCAAGGCTCACTTATGGAAGCCTAAAGGG
CTGGCCATCGCCCTGGTGGCACAGTATGGCATCATGCCCCTCACGGCCTTTGTGCTGGGC
AAGGTCTTCCGGCTGAAGAACATTGAGGCACTGGCCATCTTGGTCTGTGGCTGCTCACCT
GGAGGGAACCTGTCCAATGTCTTCAGTCTGGCCATGAAGGGGGACATGAACCTCAGCATT
GTGATGACCACCTGCTCCACCTTCTGTGCCCTTGGCATGATGCCTCTCCTCCTGTACATC
TACTCCAGGGGGATCTATGATGGGGACCTGAAGGACAAGGTGCCCTATAAAGGCATCGTG
ATATCACTGGTCCTGGTTCTCATTCCTTGCACCATAGGGATCGTCCTCAAATCCAAACGG
CCACAATACATGCGCTATGTCATCAAGGGAGGGATGATCATCATTCTCTTGTGCAGTGTG
GCCGTCACAGTTCTCTCTGCCATCAATGTGGGGAAGAGCATCATGTTTGCCATGACACCA
CTCTTGATTGCCACCTCCTCCCTGATGCCTTTTATTGGCTTTCTGCTGGGTTATGTTCTC
TCTGCTCTCTTCTGCCTCAATGGACGGTGCAGACGCACTGTCAGCATGGAGACTGGATGC
CAAAATGTCCAACTCTGTTCCACCATCCTCAATGTGGCCTTTCCACCTGAAGTCATTGGA
CCACTTTTCTTCTTTCCCCTCCTCTACATGATTTTCCAGCTTGGAGAAGGGCTTCTCCTC
ATTGCCATATTTTGGTGCTATGAGAAATTCAAGACTCCCAAGGATAAAACAAAAATGATC
TACACAGCTGCCACAACTGAAGAAACAATTCCAGGAGCTCTGGGAAATGGCACCTACAAA
GGGGAGGACTGCTCCCCTTGCACAGCCTAG
Chromosome Location
14
Locus
14q24.1
External Identifiers
ResourceLink
UniProtKB IDQ14973
UniProtKB Entry NameNTCP_HUMAN
GenBank Protein ID410214
GenBank Gene IDL21893
HGNC IDHGNC:10905
General References
  1. Hagenbuch B, Meier PJ: Molecular cloning, chromosomal localization, and functional characterization of a human liver Na+/bile acid cotransporter. J Clin Invest. 1994 Mar;93(3):1326-31. [PubMed:8132774]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Yan H, Zhong G, Xu G, He W, Jing Z, Gao Z, Huang Y, Qi Y, Peng B, Wang H, Fu L, Song M, Chen P, Gao W, Ren B, Sun Y, Cai T, Feng X, Sui J, Li W: Sodium taurocholate cotransporting polypeptide is a functional receptor for human hepatitis B and D virus. Elife. 2012 Nov 13;1:e00049. doi: 10.7554/eLife.00049. [PubMed:23150796]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00977EthinylestradiolapprovedunknowninducerDetails
DB00624Testosteroneapproved, investigationalunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB02659Cholic AcidapprovedunknownsubstrateinhibitorDetails
DB00887BumetanideapprovedunknownsubstrateinhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB01586Ursodeoxycholic acidapproved, investigationalunknownsubstrateinhibitorDetails
DB04348Taurocholic acidapproved, experimentalunknownsubstrateDetails
DB00279Liothyronineapproved, vet_approvedunknownsubstrateDetails
DB00328Indomethacinapproved, investigationalunknownsubstrateDetails
DB03619Deoxycholic acidapprovedunknownsubstrateDetails
DB02123Glycochenodeoxycholic AcidexperimentalunknownsubstrateDetails
DB01583LiotrixapprovedunknownsubstrateDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB06290SimeprevirapprovedunknowninhibitorDetails
DB13943Testosterone cypionateapprovedunknowninhibitorDetails
DB13944Testosterone enanthateapprovedunknowninhibitorDetails
DB13946Testosterone undecanoateapproved, investigationalunknowninhibitorDetails
DB01098RosuvastatinapprovedunknownDetails