Voltage-dependent L-type calcium channel subunit beta-4

Details

Name
Voltage-dependent L-type calcium channel subunit beta-4
Synonyms
  • CAB4
  • CACNLB4
  • Calcium channel voltage-dependent subunit beta 4
Gene Name
CACNB4
Organism
Human
Amino acid sequence
>lcl|BSEQ0004627|Voltage-dependent L-type calcium channel subunit beta-4
MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPS
DSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISF
DAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNS
SSSLGEMVSGTFRATPTSTAKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQK
ALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIF
ELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQ
LVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGS
TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQH
SRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL
Number of residues
520
Molecular Weight
58168.625
Theoretical pI
9.77
GO Classification
Functions
voltage-gated calcium channel activity
Processes
thymus development / transport / neuromuscular junction development / cAMP metabolic process / cellular calcium ion homeostasis / detection of light stimulus involved in visual perception / membrane depolarization / Peyer's patch development / gamma-aminobutyric acid signaling pathway / T cell receptor signaling pathway / spleen development / regulation of voltage-gated calcium channel activity / synaptic transmission / adult walking behavior / neuronal action potential propagation / axon guidance / synaptic transmission, glutamatergic / gamma-aminobutyric acid secretion / calcium ion transmembrane transport / muscle fiber development
Components
voltage-gated calcium channel complex / plasma membrane / cytosol / synapse / cytoplasmic side of plasma membrane
General Function
Voltage-gated calcium channel activity
Specific Function
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011692|Voltage-dependent L-type calcium channel subunit beta-4 (CACNB4)
ATGTCCTCCTCCTCCTACGCCAAGAACGGGACCGCGGACGGGCCGCACTCCCCCACCTCG
CAGGTGGCCCGAGGCACCACAACCCGGAGGAGCAGGTTGAAAAGATCCGATGGCAGCACC
ACTTCGACCAGCTTCATCCTCAGACAGGGTTCAGCGGATTCCTACACAAGCAGGCCGTCT
GACTCCGATGTCTCTTTGGAAGAGGACCGGGAAGCAATTCGACAGGAGAGAGAACAGCAA
GCAGCTATCCAGCTTGAGAGAGCAAAGTCCAAACCTGTAGCATTTGCCGTGAAGACAAAT
GTGAGCTACTGCGGCGCCCTGGACGAGGATGTGCCTGTTCCAAGCACAGCTATCTCCTTT
GATGCTAAAGACTTTCTACATATTAAAGAGAAATATAACAATGATTGGTGGATAGGAAGG
CTGGTGAAAGAGGGCTGTGAAATTGGCTTCATTCCAAGTCCACTCAGATTGGAGAACATA
CGGATCCAGCAAGAACAAAAAAGAGGACGTTTTCACGGAGGGAAATCAAGTGGAAATTCT
TCTTCAAGTCTTGGAGAAATGGTATCTGGGACATTCCGAGCAACTCCCACATCAACAGCA
AAACAGAAGCAAAAAGTGACGGAGCACATTCCTCCTTACGATGTTGTACCGTCAATGCGT
CCGGTGGTGTTAGTGGGGCCGTCACTGAAAGGTTACGAGGTAACAGACATGATGCAGAAA
GCCCTCTTTGATTTCCTGAAGCACAGGTTTGATGGGAGGATTTCAATAACGAGAGTGACA
GCTGACATTTCTCTTGCTAAGAGGTCTGTCCTAAATAATCCCAGCAAGAGAGCAATAATT
GAACGTTCGAACACCCGGTCCAGCTTAGCGGAAGTACAAAGTGAAATTGAAAGAATCTTT
GAGTTGGCAAGATCTTTGCAACTGGTTGTTCTTGATGCAGACACCATCAATCACCCAGCA
CAACTTATAAAGACTTCCTTAGCACCAATTATTGTTCATGTAAAAGTCTCATCTCCAAAG
GTTTTACAGCGGTTGATTAAATCTAGAGGAAAGTCACAAAGTAAACACTTGAATGTTCAA
CTGGTGGCAGCTGATAAACTTGCACAATGCCCCCCAGAAATGTTTGATGTTATATTGGAT
GAAAATCAGCTTGAGGATGCATGTGAACATCTAGGGGAGTACCTGGAGGCGTACTGGCGT
GCCACCCACACAACCAGTAGCACACCCATGACCCCGCTGCTGGGAAGGAATTTGGGCTCC
ACGGCACTCTCACCATATCCCACAGCAATTTCTGGGTTACAGAGTCAGCGAATGAGGCAC
AGCAACCACTCCACAGAGAACTCTCCAATTGAAAGACGAAGTCTAATGACCTCTGATGAA
AATTATCACAATGAAAGGGCTCGGAAGAGTAGGAACCGCTTGTCTTCCAGTTCTCAGCAT
AGCCGAGATCATTACCCTCTTGTGGAAGAAGATTACCCTGACTCATACCAGGACACTTAC
AAACCCCATAGGAACCGAGGATCACCTGGGGGATATAGCCATGACTCCCGACATAGGCTT
TGA
Chromosome Location
2
Locus
2q22-q23
External Identifiers
ResourceLink
UniProtKB IDO00305
UniProtKB Entry NameCACB4_HUMAN
GenBank Protein ID2058727
GenBank Gene IDU95020
GenAtlas IDCACNB4
HGNC IDHGNC:1404
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00661VerapamilapprovedyesinhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB00393Nimodipineapproved, investigationalyesinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium Citrateapproved, investigationalunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedyesinhibitorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09236Lacidipineapproved, investigationalyesantagonistDetails
DB09231BenidipineexperimentalyesantagonistDetails
DB09232CilnidipineinvestigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB00825MentholapprovedyesantagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails