Identification
NamePegfilgrastim
Accession NumberDB00019  (BTD00094, BIOD00094)
TypeBiotech
GroupsApproved
Description

PEGylated (at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.

Protein structureDb00019
Related Articles
Protein chemical formulaC845H1343N223O243S9
Protein average weight18802.8 Da
Sequences
> Pegfilgrastim sequence
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA
PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ
QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Download FASTA Format
Synonyms
Granulocyte colony-stimulating factor pegfilgrastim
Peg-filgrastim
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
NeulastaSolution10 mgSubcutaneousAmgen2004-03-12Not applicableCanada
NeulastaInjection6 mg/.6mLSubcutaneousAmgen2002-04-01Not applicableUs
NeulastaKitSubcutaneousAmgen2002-04-01Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-22Not applicableEu
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-22Not applicableEu
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-22Not applicableEu
International BrandsNot Available
Brand mixturesNot Available
Categories
UNII3A58010674
CAS number208265-92-3
Pharmacology
Indication

Increases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant.

Structured Indications
Pharmacodynamics

Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment, and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.

Mechanism of action

Pegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrow storage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase.

TargetKindPharmacological actionActionsOrganismUniProt ID
Granulocyte colony-stimulating factor receptorProteinyes
agonist
HumanQ99062 details
Neutrophil elastaseProteinunknownNot AvailableHumanP08246 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of elimination

Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endocytosis, and subsequent degradation inside the cells. Pegylation of filgrastim renders renal clearance insignificant, which was demonstrated in bilaterally nephrectomized rats and confirmed in subjects with renal impairment. As a result, the neutrophil-mediated clearance is the predominant elimination pathway for pegfilgrastim. During chemotherapy-induced neutropenia, the clearance of pegfilgrastim is significantly reduced and the concentration of pegfilgrastim is sustained until onset of neutrophil recovery.

Half life

15-80 hrs

ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
PegloticaseThe therapeutic efficacy of Pegfilgrastim can be decreased when used in combination with Pegloticase.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Yang BB, Kido A: Pharmacokinetics and pharmacodynamics of pegfilgrastim. Clin Pharmacokinet. 2011 May;50(5):295-306. doi: 10.2165/11586040-000000000-00000. [PubMed:21456630 ]
External Links
ATC CodesL03AA13
AHFS Codes
  • 20:16.00
PDB Entries
FDA labelDownload (50 KB)
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1Active Not RecruitingTreatmentAdult Solid Neoplasm1
1Active Not RecruitingTreatmentAdult Solid Neoplasm / Colorectal Adenocarcinoma / Metastatic Pancreatic Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Melanoma of the Skin / Recurrent Non-Small Cell Lung Carcinoma / Recurrent Pancreatic Carcinoma / Renal Cell Carcinoma Recurrent / Solid Neoplasms / Stage IV Breast Cancer / Stage IV Non-Small Cell Lung Cancer / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Colorectal Cancer / Stage IVA Pancreatic Cancer / Stage IVB Colorectal Cancer / Stage IVB Pancreatic Cancer1
1Active Not RecruitingTreatmentAmyloidosis / Multiple Myeloma (MM)1
1Active Not RecruitingTreatmentEndometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Mixed Adenocarcinoma / Endometrial Serous Adenocarcinoma / Endometrial Squamous Cell Carcinoma / Endometrial Undifferentiated Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer1
1Active Not RecruitingTreatmentLymphoma NOS1
1Active Not RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer1
1Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
1CompletedNot AvailableBioequivalence1
1CompletedNot AvailableHealthy Volunteers1
1CompletedNot AvailableImmunity, Humoral1
1CompletedNot AvailableNeutropenias1
1CompletedHealth Services ResearchHealthy Volunteers1
1CompletedOtherHealthy Volunteers1
1CompletedOtherHealthy Volunteers / Neutropenias1
1CompletedTreatmentAplastic Anaemia (AA)1
1CompletedTreatmentCancer, Advanced1
1CompletedTreatmentCancer, Advanced / Metastatic Cancers1
1CompletedTreatmentCarcinoma of the Prostate1
1CompletedTreatmentCrohn's Disease (CD)1
1CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
1CompletedTreatmentFallopian Tube Carcinoma / Infectious Disorder / Neutropenias / Ovarian Carcinosarcoma / Primary Peritoneal Carcinoma / Stage III Ovarian Cancer / Stage IV Ovarian Cancer1
1CompletedTreatmentGlioblastomas / Gliosarcoma1
1CompletedTreatmentHealthy Volunteers2
1CompletedTreatmentPharmacology, Clinical1
1CompletedTreatmentRecurrent Neuroblastoma / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentSystemic Sclerosis1
1RecruitingTreatmentBioequivalence1
1RecruitingTreatmentCarcinoma of the Prostate1
1RecruitingTreatmentChildhood Solid Tumors1
1RecruitingTreatmentGraft Versus Host Disease (GVHD) / Healthy Volunteers / Lymphopenia1
1RecruitingTreatmentHodgkins Disease (HD) / Lymphoma, Large B-Cell, Diffuse / Lymphoma, T-Cell, Cutaneous / Lymphoma, T-Cell, Peripheral1
1RecruitingTreatmentMantle Cell Lymphoma (MCL)1
1RecruitingTreatmentMetastatic Triple Negative Breast Cancer1
1RecruitingTreatmentMyelomas1
1RecruitingTreatmentNeoplasms Metastasis / Neoplasms, Colorectal1
1TerminatedTreatmentCancer, Breast1
1TerminatedTreatmentLung Metastases / Osteosarcomas1
1Unknown StatusTreatmentNeutropenias1
1WithdrawnTreatmentAcute Myeloid Leukaemias (AML)1
1, 2Active Not RecruitingTreatmentAnaplastic Large Cell Lymphoma / Lymphoma, Hodgkins1
1, 2Active Not RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
1, 2Active Not RecruitingTreatmentDiffuse Large B Cell Lymphoma Refractory / Diffuse Large B Cell Lymphoma Relapsed1
1, 2CompletedTreatmentAML / MDS1
1, 2CompletedTreatmentAcute Myeloblastic Leukemia1
1, 2CompletedTreatmentCancer, Breast1
1, 2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cavity Cancer1
1, 2CompletedTreatmentInfertility, Female1
1, 2CompletedTreatmentLeukemias / Lymphoma NOS1
1, 2CompletedTreatmentLeukemias / Richter's Transformation1
1, 2CompletedTreatmentLymphoma NOS / Non Hodgkin Lymphoma (NHL)1
1, 2CompletedTreatmentLymphoma, B-Cell / Lymphoma, Large-Cell, Diffuse1
1, 2CompletedTreatmentLymphoma, Hodgkins1
1, 2CompletedTreatmentMetastatic Breast Cancer (MBC)1
1, 2CompletedTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2Not Yet RecruitingTreatmentAutoimmune Diseases / Diabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 1 / Hypoglycemia1
1, 2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
1, 2RecruitingTreatmentLymphoma NOS1
1, 2RecruitingTreatmentSarcomas1
1, 2TerminatedTreatmentAggressive Marginal Zone Lymphoma (MZL) / Burkitt Lymphoma (BL) / Diffuse Large B-Cell Lymphoma (DLBCL) / Follicular Lymphoma Grade III (FL III°) / Mantle Cell Lymphoma (MCL), Blastoid Variant1
1, 2TerminatedTreatmentCarcinoma of the Prostate / Pain1
1, 2TerminatedTreatmentHead and Neck Cancers1
1, 2TerminatedTreatmentInfertility, Female1
1, 2TerminatedTreatmentMale Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
1, 2Unknown StatusTreatmentCritical Limb Ischemia (CLI) / Diabetic Foot / Leg Ulcers1
2Active Not RecruitingTreatmentAdult B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentCancer, Breast2
2Active Not RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
2Active Not RecruitingTreatmentHER2-Positive Early Stage Breast Cancer1
2Active Not RecruitingTreatmentLeukemias1
2Active Not RecruitingTreatmentLeukemias / Lymphoma NOS1
2Active Not RecruitingTreatmentLymphoma NOS1
2Active Not RecruitingTreatmentLymphoma, Hodgkins1
2CompletedNot AvailableCancer, Breast1
2CompletedPreventionMultiple Myeloma (MM)1
2CompletedPreventionNeutropenias / Sarcomas1
2CompletedPreventionUnresectable Locally Advanced NSCLC1
2CompletedSupportive CareColon Cancer / Colorectal Cancers / Rectal Cancers1
2CompletedSupportive CareLung Cancers1
2CompletedSupportive CareLymphoma NOS / Neutropenias1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Non-Small-Cell Lung Carcinoma (NSCLC) / Recurrent Non-small Cell Lung Cancer / Squamous Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAnemias / Drug/Agent Toxicity by Tissue/Organ / Lung Cancers / Neutropenias1
2CompletedTreatmentAplastic Anaemia (AA) / Myelodysplastic Syndrome1
2CompletedTreatmentBladder Cancers / Muscle-invasive Bladder Cancer1
2CompletedTreatmentBlood Cancers / Leukemias1
2CompletedTreatmentBone Pain in Stage I - III Breast Cancer1
2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Extragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
2CompletedTreatmentCancer of Head and Neck / Cancer, Ovarian / Carcinoma of the Prostate / Colorectal Cancers / Esophageal Cancers / Gastric Cancers / Non Small Cell Lung Cancer (NSCLC)1
2CompletedTreatmentCancer, Breast5
2CompletedTreatmentCancer, Breast / Cancer, Ovarian / Lung Cancers1
2CompletedTreatmentCancer, Breast / Fevers / Neutropenias1
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentCancer, Breast / Neoplasms, Breast1
2CompletedTreatmentCancer, Breast / Stage I Breast Cancer / Stage II Breast Cancer1
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
2CompletedTreatmentCancer, Ovarian / Peritoneal Cavity Cancer1
2CompletedTreatmentCarcinoma of Head/Neck / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentCarcinoma, Urothelial1
2CompletedTreatmentCervical Adenocarcinoma / Cervical Adenosquamous Carcinoma / Cervical Small Cell Carcinoma / Cervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma / Stage III Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2CompletedTreatmentChemotherapy Induced Neutropenia1
2CompletedTreatmentContiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma1
2CompletedTreatmentContiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Stage I Mantle Cell Lymphoma / Stage III Mantle Cell Lymphoma / Stage IV Mantle Cell Lymphoma1
2CompletedTreatmentDiamond Blackfan Anemia1
2CompletedTreatmentDistal Urethral Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Proximal Urethral Cancer / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Regional Transitional Cell Cancer of the Renal Pelvis and Ureter / Stage III Bladder Cancer / Stage IV Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Urethral Cancer Associated With Invasive Bladder Cancer1
2CompletedTreatmentEsophageal Cancers1
2CompletedTreatmentExtensive-Stage Small Cell Lung Cancer1
2CompletedTreatmentExtragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
2CompletedTreatmentFemale Breast Cancer1
2CompletedTreatmentHematological Neoplasms / Tumors1
2CompletedTreatmentHematology / Lymphoma NOS / Lymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL) / Oncology1
2CompletedTreatmentHodgkins Disease (HD) / Leukaemia, Lymphoblastic / Multiple Myeloma (MM) / Myelogenous Leukemia / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentLeukemia, Myelocytic, Acute1
2CompletedTreatmentLeukemias / Lymphoma NOS3
2CompletedTreatmentLymphoma NOS8
2CompletedTreatmentLymphoma NOS / Myelomas1
2CompletedTreatmentMale Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer1
2CompletedTreatmentMetastatic Breast Cancer (MBC)1
2CompletedTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Carcinoma With Sarcomatoid Features1
2CompletedTreatmentMultiple Myeloma (MM)2
2CompletedTreatmentMyeloid Leukemias1
2CompletedTreatmentNeoplasms, Breast1
2CompletedTreatmentNeoplasms, Ovarian1
2CompletedTreatmentNeuroblastomas / Rhabdomyosarcomas / Sarcoma, Ewing's1
2CompletedTreatmentNeutropenias2
2CompletedTreatmentNon Small Cell Lung Cancer (NSCLC)1
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)4
2CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentRecurrent Uterine Corpus Sarcoma / Uterine Corpus Leiomyosarcoma1
2CompletedTreatmentSarcomas3
2Enrolling by InvitationTreatmentChronic Chagasic Myocarditis1
2Not Yet RecruitingPreventionCancer, Breast / Febrile Neutropenia / Neutropenias1
2Not Yet RecruitingTreatmentAlcoholic Hepatitis (AH)1
2RecruitingNot AvailableCancer, Breast / Locally Advanced Malignant Neoplasm1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2RecruitingTreatmentCarcinoma of the Prostate1
2RecruitingTreatmentEarly Stage Breast Cancer1
2RecruitingTreatmentLeukemias5
2RecruitingTreatmentLymphoma NOS1
2RecruitingTreatmentLymphoma, Hodgkins1
2RecruitingTreatmentNeutropenias1
2RecruitingTreatmentRetinoblastoma1
2RecruitingTreatmentRhabdomyosarcomas1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Carcinoma, Head And Neck1
2TerminatedTreatmentBone Cancer / Sarcoma, Ewing's1
2TerminatedTreatmentBrain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Lymphoma NOS / Thrombocytopenias1
2TerminatedTreatmentCancer of the Breast / Cancer, Breast / Neoplasms, Breast / Tumors, Breast1
2TerminatedTreatmentCancer, Ovarian1
2TerminatedTreatmentDiffuse Large B-Cell Lymphoma (DLBCL)1
2TerminatedTreatmentHead and Neck Cancers1
2TerminatedTreatmentHematologic Diseases1
2TerminatedTreatmentMelanoma Metastatic1
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)3
2TerminatedTreatmentPreviously Treated Non Small Cell Lung Cancer1
2TerminatedTreatmentSolid Malignancies1
2Unknown StatusTreatmentAcute Myeloid Leukaemias (AML)1
2Unknown StatusTreatmentBortezomib / Cyclophosphamide / Dexamethasone / Granulocyte Colony-Stimulating Factor / Myelomas1
2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
2Unknown StatusTreatmentDiffuse Large B Cell Lymphoma (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
2Unknown StatusTreatmentHER2-Negative Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Unknown StatusTreatmentLeukemias1
2Unknown StatusTreatmentLymphoma NOS2
2Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2Unknown StatusTreatmentSolid Malignancies1
2WithdrawnTreatmentAnterior Urethral Cancer / Localized Transitional Cell Cancer of the Renal Pelvis and Ureter / Posterior Urethral Cancer / Recurrent Bladder Cancer / Recurrent Urethral Cancer / Regional Transitional Cell Cancer of the Renal Pelvis and Ureter / Stage III Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Ureter Cancer / Urethral Cancer Associated With Invasive Bladder Cancer1
2, 3CompletedPreventionChemotherapy Induced Neutropenia1
2, 3CompletedSupportive CareChemotherapy-Induced Neutropenia1
2, 3CompletedTreatmentAcute Myeloid Leukaemias (AML)1
2, 3CompletedTreatmentChronic Ischaemic Heart Failure1
2, 3RecruitingTreatmentCastrate Resistant Prostate Cancer (CRPC)1
2, 3RecruitingTreatmentLiver Cirrhosis1
2, 3TerminatedTreatmentAML / Leukemia, Lymphocytic, Acute / MDS1
2, 3Unknown StatusTreatmentDe Novo Akute Myeloid Leukemia (AML) / Refractory Anemia With Excess of Blasts in Transformation / Secondary Acute Myeloid Leukemia (AML)1
3Active Not RecruitingTreatmentCancer, Breast3
3Active Not RecruitingTreatmentEndometrial Cancers / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIB Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer1
3Active Not RecruitingTreatmentLarge B Cell Lymphoma1
3Active Not RecruitingTreatmentLocally Advanced or Metastatic Non Small Cell Lung Cancer Stage IIIb - IV1
3Active Not RecruitingTreatmentLymphoma NOS1
3CompletedPreventionNeutropenias1
3CompletedSupportive CareBreast Cancer Patients Treated With Myelosuppressive Chemotherapy / Neutropenic Complications1
3CompletedSupportive CareCancer, Breast / Chemotherapy-Induced Neutropenia1
3CompletedSupportive CareCancers / Colon Cancer / Colorectal Cancers / Fevers / Locally Advanced / Metastatic Colorectal Cancers / Neutropenias / Rectal Cancers1
3CompletedSupportive CareChemotherapy-Induced Neutropenia1
3CompletedTreatmentAcute Myeloid Leukaemias (AML)1
3CompletedTreatmentCancer, Breast4
3CompletedTreatmentChemotherapy Induced Neutropenia1
3CompletedTreatmentChemotherapy-Induced Febrile Neutropenia / Neoplasms, Breast1
3CompletedTreatmentDiffuse Large B Cell Lymphoma (DLBCL) / Elderly Patients (>65 Years)1
3CompletedTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Endometrioid Adenocarcinoma, Variant With Squamous Differentiation / Endometrial Serous Adenocarcinoma / Stage III Uterine Corpus Cancer1
3CompletedTreatmentRecurrent Uterine Corpus Sarcoma / Stage IIIA Uterine Sarcoma / Stage IIIB Uterine Sarcoma / Stage IIIC Uterine Sarcoma / Stage IVA Uterine Sarcoma / Stage IVB Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3CompletedTreatmentSarcomas1
3CompletedTreatmentWomen With Recurrent Implantation Failure (Three Previous IVF Attempts Failed and at Least 8 Good Embryos Replaced1
3Not Yet RecruitingPreventionLymphoma NOS / Neutropenias1
3Not Yet RecruitingTreatmentBreastcancer / Neutropenias1
3RecruitingTreatmentAcute Myeloid Leukaemias (AML)1
3RecruitingTreatmentAggressive B Cell Non-Hodgkin Lymphomas at High Risk for R-CHOP-21-induced Neutropenia1
3RecruitingTreatmentCancer, Breast / Neutropenias1
3RecruitingTreatmentChildhood Teratoma / Choriocarcinoma / Extragonadal Seminoma / Germ Cell Tumors / Germinoma / Malignant Germ Cell Neoplasm / Mixed Germ Cell Tumor / Non-seminomatous Germ Cell Tumors / Seminoma / Teratoma / Yolk Sac Tumor1
3RecruitingTreatmentGerm Cell Tumors1
3RecruitingTreatmentMyelokathexis / Neutropenias / Warts / WHIMS1
3RecruitingTreatmentStage I Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3TerminatedPreventionCancer treatment / Cancer, Breast / Febrile Neutropenia1
3TerminatedTreatmentAplastic Anaemia (AA)1
3TerminatedTreatmentLung Cancers1
3Unknown StatusTreatmentCancer, Breast2
3Unknown StatusTreatmentDiffuse Large B-Cell Lymphoma (DLBCL) / IPI≥21
3Unknown StatusTreatmentLymphoma NOS1
3Unknown StatusTreatmentLymphoma, Mantle-Cell1
4CompletedPreventionCancer, Breast2
4CompletedPreventionCancer, Breast / Cancer, Ovarian / Lung Cancers / Neutropenias / Non-Hodgkin's Lymphoma (NHL)1
4CompletedPreventionLymphoma NOS1
4CompletedPreventionMalignant Solid Tumors1
4CompletedTreatmentAbortion, Habitual1
4CompletedTreatmentAcute Myeloblastic Leukemia / Myelodysplastic Syndrome1
4CompletedTreatmentAdult Acute Lymphocytic Leukemia2
4CompletedTreatmentBurkitt's Leukemia / Burkitt's Lymphoma / Large Cell Anaplastic Lymphoma / Lymphoma, Lymphoblastic / Mediastinal Neoplasms1
4CompletedTreatmentLymphoma, Lymphoblastic1
4CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
4CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
4RecruitingTreatmentAlcoholic Liver Diseases / Hepatitis B / Liver Failure1
4Unknown StatusSupportive CareCancer, Breast / Neutropenias1
4Unknown StatusTreatmentAcute Myeloid Leukaemias (AML)1
4Unknown StatusTreatmentAdult Acute Lymphocytic Leukemia1
Not AvailableActive Not RecruitingNot AvailableCancer, Breast / Lung Cancers1
Not AvailableActive Not RecruitingDiagnosticSarcomas1
Not AvailableActive Not RecruitingTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Squamous Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer1
Not AvailableCompletedPreventionSarcomas1
Not AvailableCompletedTreatmentCancer, Breast2
Not AvailableCompletedTreatmentCirrhosis, Decompensated1
Not AvailableCompletedTreatmentCoronary Artery Disease1
Not AvailableCompletedTreatmentMyocardial Infarction (MI)1
Not AvailableRecruitingNot AvailableCancer, Breast1
Not AvailableRecruitingTreatmentLymphoma NOS1
Not AvailableRecruitingTreatmentMetastatic Pheochromocytoma / Relapsed Neuroblastoma1
Not AvailableRecruitingTreatmentSevere Alcoholic Hepatitis1
Not AvailableTerminatedOtherAcute Myeloid Leukaemias (AML)1
Not AvailableTerminatedTreatmentMalignancies, Hematologic1
Not AvailableTerminatedTreatmentNon Hodgkin Lymphoma (NHL)1
Not AvailableUnknown StatusTreatmentCancer, Breast1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
InjectionSubcutaneous6 mg/.6mL
KitSubcutaneous
SolutionSubcutaneous10 mg
Injection, solutionSubcutaneous6 mg
Prices
Unit descriptionCostUnit
Neulasta 6 mg/0.6 ml syringe4102.37USD syringe
Neulasta 6 mg/0.6ml Solution 0.6ml Syringe4026.05USD syringe
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339071 No1997-07-292014-07-29Canada
CA1341537 No2007-07-312024-07-31Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point (°C)60 °CLuo, P., Protein Science 11:1218-1226 (2002)
hydrophobicity0.209Not Available
isoelectric point5.65Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
Gene Name:
CSF3R
Uniprot ID:
Q99062
Molecular Weight:
92155.615 Da
References
  1. Erkeland SJ, Aarts LH, Irandoust M, Roovers O, Klomp A, Valkhof M, Gits J, Eyckerman S, Tavernier J, Touw IP: Novel role of WD40 and SOCS box protein-2 in steady-state distribution of granulocyte colony-stimulating factor receptor and G-CSF-controlled proliferation and differentiation signaling. Oncogene. 2007 Mar 29;26(14):1985-94. Epub 2006 Sep 25. [PubMed:17001306 ]
  2. Elsasser A, Franzen M, Kohlmann A, Weisser M, Schnittger S, Schoch C, Reddy VA, Burel S, Zhang DE, Ueffing M, Tenen DG, Hiddemann W, Behre G: The fusion protein AML1-ETO in acute myeloid leukemia with translocation t(8;21) induces c-jun protein expression via the proximal AP-1 site of the c-jun promoter in an indirect, JNK-dependent manner. Oncogene. 2003 Aug 28;22(36):5646-57. [PubMed:12944913 ]
  3. Ward AC: The role of the granulocyte colony-stimulating factor receptor (G-CSF-R) in disease. Front Biosci. 2007 Jan 1;12:608-18. [PubMed:17127322 ]
  4. Zhuang D, Qiu Y, Haque SJ, Dong F: Tyrosine 729 of the G-CSF receptor controls the duration of receptor signaling: involvement of SOCS3 and SOCS1. J Leukoc Biol. 2005 Oct;78(4):1008-15. Epub 2005 Jul 20. [PubMed:16033816 ]
  5. Cao YR, Shao ZH, Liu H, Shi J, Bai J, Tu MF, Wang HQ, Xing LM, Cui ZZ, Sun J, Jia HR, Yang TY: [The response of bone marrow hematopoietic cells to G-CSF in paroxysmal nocturnal hemoglobinuria patients]. Zhonghua Xue Ye Xue Za Zhi. 2005 Apr;26(4):235-8. [PubMed:15949269 ]
  6. Kotto-Kome AC, Fox SE, Lu W, Yang BB, Christensen RD, Calhoun DA: Evidence that the granulocyte colony-stimulating factor (G-CSF) receptor plays a role in the pharmacokinetics of G-CSF and PegG-CSF using a G-CSF-R KO model. Pharmacol Res. 2004 Jul;50(1):55-8. [PubMed:15082029 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis.
Gene Name:
ELANE
Uniprot ID:
P08246
Molecular Weight:
28517.81 Da
References
  1. Carter CR, Whitmore KM, Thorpe R: The significance of carbohydrates on G-CSF: differential sensitivity of G-CSFs to human neutrophil elastase degradation. J Leukoc Biol. 2004 Mar;75(3):515-22. Epub 2003 Dec 4. [PubMed:14657210 ]
  2. Jian MY, Koizumi T, Tsushima K, Fujimoto K, Kubo K: Effects of granulocyte colony-stimulating factor (G-CSF) and neutrophil elastase inhibitor (ONO-5046) on acid-induced lung injury in rats. Inflammation. 2004 Dec;28(6):327-36. [PubMed:16245075 ]
  3. Pelus LM, Bian H, King AG, Fukuda S: Neutrophil-derived MMP-9 mediates synergistic mobilization of hematopoietic stem and progenitor cells by the combination of G-CSF and the chemokines GRObeta/CXCL2 and GRObetaT/CXCL2delta4. Blood. 2004 Jan 1;103(1):110-9. Epub 2003 Sep 4. [PubMed:12958067 ]
  4. Druhan LJ, Ai J, Massullo P, Kindwall-Keller T, Ranalli MA, Avalos BR: Novel mechanism of G-CSF refractoriness in patients with severe congenital neutropenia. Blood. 2005 Jan 15;105(2):584-91. Epub 2004 Sep 7. [PubMed:15353486 ]
  5. Schepers H, Wierenga AT, van Gosliga D, Eggen BJ, Vellenga E, Schuringa JJ: Reintroduction of C/EBPalpha in leukemic CD34+ stem/progenitor cells impairs self-renewal and partially restores myelopoiesis. Blood. 2007 Aug 15;110(4):1317-25. Epub 2007 May 2. [PubMed:17475913 ]
Drug created on June 13, 2005 07:24 / Updated on January 03, 2017 10:41