Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Pegfilgrastim
Accession Number
DB00019  (BTD00094, BIOD00094)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Haematopoietic growth factors
Description

Pegfilgrastim is a PEGylated form of the recombinant human granulocyte colony-stimulating factor (G-CSF) analogue, filgrastim.2 It is used to decrease the incidence of infection, as manifested by febrile neutropenia, in patients with with non-myeloid cancer receiving myelosuppressive anti-cancer treatment. Some patients with greater risk factors may develop febrile neutropenia from myelosuppressive therapy and are susceptible to an increased risk of developing infections. Although the risk of developing febrile neutropenia is less than 20% in many readily used chemotherapy regimens,9 infections pose risks of hospitalization and mortalities.4 Due to the relatively short circulating half-life of filgrastim, a 20 kDa PEG moiety was covalently conjugated to the N-terminus of filgrastim (at the methionine residue) to develop a longer acting version of the drug.1,3 Due to a longer half-life and slower elimination rate than filgrastim, pegfilgrastim requires less frequent dosing than filgrastim. However, pegfilgrastim retains the same biological activity as filgrastim and binds to the same G-CSF receptor to stimulate the proliferation, differentiation, and activation of neutrophils.3

First developed by Amgen, pegfilgrastim was initially approved by the FDA in 2002 and marketed as Neulasta®. It is typically administered via a subcutaneous injection. There are several pegfilgrastim biosimilars (Fulphila®, Pelgraz® or Lapelga®, Pelmeg®, Udenyca®, Ziextenzo®, and Grasustek®) that are approved for the same therapeutic indication by Health Canada, European Union (EU), and FDA.8,10 These biosimilars are highly similar to the reference product, Neulasta®, in terms of pharmacological and pharmacokinetic profile and condition(s) of use, such as the therapeutic indication(s), dosing regimen(s), strength(s), dosage form(s), and route(s) of administration.11

Protein structure
Db00019
Protein chemical formula
C845H1343N223O243S9
Protein average weight
39000.0 Da (approximate, PEGylated)
Sequences
> Pegfilgrastim sequence
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA
PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ
QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Download FASTA Format
Synonyms
  • Granulocyte colony-stimulating factor pegfilgrastim
  • peg-filgrastim
  • pegfilgrastim-bmez
  • pegfilgrastim-cbqv
  • pegfilgrastim-jmdb
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
FulphilaSolution10 mgSubcutaneousBgp Pharma UlcNot applicableNot applicableCanada
FulphilaInjection6 mg/0.6mLSubcutaneousMylan Institutional LLC2018-07-09Not applicableUs
LapelgaSolutionSubcutaneousApotex Corporation2019-02-27Not applicableCanada
NeulastaInjection6 mg/0.6mLSubcutaneousAMGEN INC2002-04-01Not applicableUs
NeulastaKit6 mg/0.6mLSubcutaneousAMGEN INC2002-04-01Not applicableUs
NeulastaSolution10 mgSubcutaneousAmgen2004-03-12Not applicableCanada
NeulastaInjection6 mg/0.6mLSubcutaneousPhysicians Total Care, Inc.2006-02-232011-12-31Us
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-222008-12-22Eu
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-222008-12-22Eu
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-222008-12-22Eu
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
3A58010674
CAS number
208265-92-3

Pharmacology

Indication

Pegfilgrastim is indicated to decrease the incidence of infection, as manifested by febrile neutropenia, in patients with non­ myeloid malignancies receiving myelosuppressive anti-cancer drugs associated with a clinically significant incidence of febrile neutropenia.6

It is also indicated to increase survival in patients acutely exposed to myelosuppressive doses of radiation (Hematopoietic Subsyndrome of Acute Radiation Syndrome).6

Associated Conditions
Pharmacodynamics

Pegfilgrastim is a recombinant human granulocyte colony-stimulating factor (G-CSF) that promotes the production, proliferation, and maturation of neutrophils, which are white blood cells involved in both innate and adaptive immune responses.4,9 The safety and efficacy of pegfilgrastim in reducing the risk of febrile neutropenia and infections have been demonstrated in various tumor types and settings.4

During chemotherapy-induced neutropenia, the clearance of pegfilgrastim is significantly reduced and the concentration of pegfilgrastim is sustained until the onset of neutrophil recovery.1 Serum concentrations of pegfilgrastim decline as the neutrophil count increases as neutrophil and neutrophil precursors are involved in cell-mediated clearance of the drug.2 Due the addition of polyethylene glycol group to its structure, Pegfilgrastim is a long-acting form of filgrastim with an extended serum half-life and reduced renal clearance.3 Although it is more slowly absorbed than filgrastim, self-regulation of pegfilgrastim is more efficient and the drug effects are maintained during one chemotherapy cycle (2-3 weeks).1

Mechanism of action

Neutrophils are short-lived immune cells that are highly susceptible to cell death following myelosuppressive chemotherapy. This marked reduction in neutrophil numbers during chemotherapy increases the risk of hospitalization, infection, and infection-related mortality. It also directly impacts the clinical outcome of patients if cases of febrile neutropenia requires dose reductions or schedule delay of chemotherapy, thus reducing the clinical efficacy of chemotherapy and patient benefit from receiving appropriate treatment.4

G-CSF is an endogenous haematopoietic growth factor that stimulates granulopoietic cells of the neutrophil lineage. Pegfilgrastim mimics its biological actions and binds to the same G-CSF receptor expressed on cells of myeloid lineage, such as granulocytic precursors and mature neutrophils.1 Upon binding of the ligand, G-CSF receptor undergoes a conformational change and activates several downstream signalling pathways including JAK/STAT, PI3K/AKT and MAPK/ERK.5 These pathways work to increase proliferation and differentiation of granulocyte progenitor cells, induce maturation of the progenitor cells, and enhance survival and function of mature neutrophils.1

TargetActionsOrganism
AGranulocyte colony-stimulating factor receptor
agonist
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Pegfilgrastim has a lower absolute bioavailability than filgrastim following subcutaneous administration. The absorption of pegfilgrastim is largely dependent on the lymphatic system due to the attached PEG group contributing to the large size of the drug. It is slowly absorbed following subcutaneous administration with a time to peak concentration (Tmax) of about 1-2 days.1

Volume of distribution

Pegfilgrastim appears to have a volume of distribution of approximately 170L.[A33290]

Protein binding

The plasma protein binding of pegfilgrastim is unlikely.12

Metabolism

It is not know whether pegfilgrastim is metabolized into major metabolites.12 Once it binds to the therapeutic target, pegfilgrastim is internalized by the neutrophil and undergoes nonspecific degradation.1

Route of elimination

The polyethylene glycol moiety limits the renal clearance by glomerular filtration of pegfilgrastim, making neutrophil-mediated clearance as the predominant route of elimination.3 This elimination pathway is initiated by the binding of pegfilgrastim to the G-CSF receptor on the neutrophil cell surface, leading to the internalization of the pegfilgrastim-receptor complex via endocytosis and subsequent degradation inside the cell. While hepatic clearance has not been well characterized for pegfilgrastim, its non-PEGylated precursor filgrastim is known to be unaffected by changes in hepatic clearance.1

Half life

The serum half-life of Pegfilgrastim is highly variable depending on the absolute neutrophil count, with the range of 15 to 80 hours following subcutaneous administration. The median serum half-life of 42 hours.3,6

Clearance

Pegfilgrastim has a self-regulating clearance that involves neutrophil-induced clearance.1,4 The clearance is dependent on the number of neutrophils and body weight of the patient: the clearance increases with increasing number of granulocytes and lower body weights.6 Pegfilgrastim is not eliminated from the circulation until neutrophils start to recover following chemotherapy-induced neutropenia and its clearance is increased as neutrophil counts also increase.4 The apparent serum clearance is 14 mL/h/kg.12

Toxicity

The maximum safe dose of pegfilgrastim has not been established; however, the highest dose used in clinical trials was 300 mcg/kg.9 Overdosage of pegfilgrastim may result in leukocytosis and bone pain. Events of edema, dyspnea, and pleural effusion have been reported in a single patient who self-administered pegfilgrastim on 8 consecutive days in error. In the event of overdose, the patient should be monitored for signs and symptoms of toxicity and responded with appropriate general supportive care.6,9

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
Abicipar PegolThe therapeutic efficacy of Abicipar Pegol can be decreased when used in combination with Pegfilgrastim.
Antihemophilic Factor (Recombinant), PEGylatedThe therapeutic efficacy of Antihemophilic Factor (Recombinant), PEGylated can be decreased when used in combination with Pegfilgrastim.
Cepeginterferon alfa-2BThe therapeutic efficacy of Cepeginterferon alfa-2B can be decreased when used in combination with Pegfilgrastim.
Certolizumab pegolThe therapeutic efficacy of Certolizumab pegol can be decreased when used in combination with Pegfilgrastim.
CyclophosphamideThe risk or severity of pulmonary toxicity can be increased when Pegfilgrastim is combined with Cyclophosphamide.
Damoctocog alfa pegolThe therapeutic efficacy of Damoctocog alfa pegol can be decreased when used in combination with Pegfilgrastim.
Egaptivon pegolThe therapeutic efficacy of Egaptivon pegol can be decreased when used in combination with Pegfilgrastim.
ElapegademaseThe therapeutic efficacy of Elapegademase can be decreased when used in combination with Pegfilgrastim.
Eptacog alfa pegol (activated)The therapeutic efficacy of Eptacog alfa pegol (activated) can be decreased when used in combination with Pegfilgrastim.
GlycoPEG-GCSFThe therapeutic efficacy of GlycoPEG-GCSF can be decreased when used in combination with Pegfilgrastim.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Yang BB, Kido A: Pharmacokinetics and pharmacodynamics of pegfilgrastim. Clin Pharmacokinet. 2011 May;50(5):295-306. doi: 10.2165/11586040-000000000-00000. [PubMed:21456630]
  2. Curran MP, Goa KL: Pegfilgrastim. Drugs. 2002;62(8):1207-13; discussion 1214-5. doi: 10.2165/00003495-200262080-00012. [PubMed:12010086]
  3. Molineux G: The design and development of pegfilgrastim (PEG-rmetHuG-CSF, Neulasta). Curr Pharm Des. 2004;10(11):1235-44. doi: 10.2174/1381612043452613. [PubMed:15078138]
  4. Arvedson T, O'Kelly J, Yang BB: Design Rationale and Development Approach for Pegfilgrastim as a Long-Acting Granulocyte Colony-Stimulating Factor. BioDrugs. 2015 Jun;29(3):185-98. doi: 10.1007/s40259-015-0127-4. [PubMed:25998211]
  5. Dwivedi P, Greis KD: Granulocyte colony-stimulating factor receptor signaling in severe congenital neutropenia, chronic neutrophilic leukemia, and related malignancies. Exp Hematol. 2017 Feb;46:9-20. doi: 10.1016/j.exphem.2016.10.008. Epub 2016 Oct 24. [PubMed:27789332]
  6. Neulasta (pegfilgrastim) - FDA Label [Link]
  7. Neulasta Safety Data Sheet - Amgen [Link]
  8. Biosimilars of pegfilgrastim [Link]
  9. Pegfilgrastim - StatPearls - NCBI Bookshelf [Link]
  10. EMA approval for pegfilgrastim biosimilar Grasustek [Link]
  11. Biosimilar and Interchangeable Products | FDA [Link]
  12. pegfilgrastim | Cancer Care Ontario [Link]
External Links
UniProt
P09919
Genbank
X03438
KEGG Drug
D06889
PubChem Substance
46505853
ChEMBL
CHEMBL1201568
Therapeutic Targets Database
DAP000395
PharmGKB
PA164781387
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Pegfilgrastim
ATC Codes
L03AA13 — Pegfilgrastim
AHFS Codes
  • 20:16.00 — Hematopoietic Agents

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0RecruitingTreatmentMetastatic Pheochromocytoma / Relapsed Neuroblastoma1
1Active Not RecruitingTreatmentAdult Solid Neoplasm1
1Active Not RecruitingTreatmentChildhood Solid Tumors1
1Active Not RecruitingTreatmentHodgkins Disease (HD) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Lymphoma, T-Cell, Cutaneous / Lymphoma, T-Cell, Peripheral1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Tumors, Solid1
1Active Not RecruitingTreatmentMalignant Lymphomas1
1Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL)1
1Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
1CompletedNot AvailableBioequivalence1
1CompletedNot AvailableHealthy Volunteers1
1CompletedNot AvailableImmunity, Humoral1
1CompletedNot AvailableNeutropenia1
1CompletedHealth Services ResearchHealthy Volunteers1
1CompletedOtherHealthy Volunteers4
1CompletedOtherHealthy Volunteers / Immunogenicity1
1CompletedOtherHealthy Volunteers / Neutropenia1
1CompletedOtherPharmacokinetic Bioequivalence Study in Human Healthy Volunteers1
1CompletedPreventionBreast Cancer1
1CompletedTreatmentBioequivalence1
1CompletedTreatmentCancer, Advanced1
1CompletedTreatmentCancer, Advanced / Metastatic Cancers1
1CompletedTreatmentEndometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Mixed Adenocarcinoma / Endometrial Serous Adenocarcinoma / Endometrial Squamous Cell Carcinoma / Endometrial Undifferentiated Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer1
1CompletedTreatmentFallopian Tube Carcinoma / Infectious Disorder / Neutropenia / Ovarian Carcinosarcoma / Primary Peritoneal Carcinoma / Stage III Ovarian Cancer / Stage IV Ovarian Cancer1
1CompletedTreatmentGlioblastomas / Gliosarcoma1
1CompletedTreatmentHealthy Volunteers4
1CompletedTreatmentMetastatic Castration Resistant Prostate Cancer1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentPharmacology, Clinical1
1CompletedTreatmentProstate Cancer1
1CompletedTreatmentRecurrent Neuroblastoma / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
1Not Yet RecruitingTreatmentGrade 3b Follicular Lymphoma / Non-Hodgkin's Lymphoma (NHL) / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Refractory Diffuse Large B Cell Lymphoma1
1RecruitingTreatmentAmyloidosis / Multiple Myeloma (MM)1
1RecruitingTreatmentAnn Arbor Stage II Diffuse Large B-Cell Lymphoma / Ann Arbor Stage III Diffuse Large B-Cell Lymphoma / Ann Arbor Stage IV Diffuse Large B-Cell Lymphoma / CD20 Negative / CD20 Positive / HIV Positivity / Human Immunodeficiency Virus Positive / Lymphoma, AIDS Related / Stage II Diffuse Large B-Cell Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma1
1RecruitingTreatmentBrain Cancer / Brain Tumor, Pediatric / Brain Tumor, Refractory / Central Nervous System Neoplasms / Cns Cancer / Medulloblastoma, Non-WNT/Non-SHH / Medulloblastoma, Non-WNT/Non-SHH, Group 3 / Medulloblastoma, Non-WNT/Non-SHH, Group 4 / Medulloblastomas / Neoplasms, Brain / Recurrent Brain Tumors / Recurrent Medulloblastoma / Tumors of the Central Nervous System1
1RecruitingTreatmentCoronary Artery Atherosclerosis1
1RecruitingTreatmentMalignancies / Neoplasms / Neuroendocrine Tumors / Tumors1
1TerminatedTreatmentAdult Solid Neoplasm / Colorectal Adenocarcinoma / Pancreatic Adenocarcinoma Metastatic / Recurrent Breast Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Melanoma of the Skin / Recurrent Non-Small Cell Lung Carcinoma / Recurrent Pancreatic Carcinoma / Renal Cell Carcinoma Recurrent / Solid Neoplasms / Stage IV Breast Cancer / Stage IV Non-Small Cell Lung Cancer / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Colorectal Cancer / Stage IVA Pancreatic Cancer / Stage IVB Colorectal Cancer / Stage IVB Pancreatic Cancer1
1TerminatedTreatmentBreast Cancer1
1TerminatedTreatmentLung Cancer Metastatic / Sarcoma, Osteogenic1
1Unknown StatusTreatmentNeutropenia1
1Unknown StatusTreatmentPharmacokinetics1
1, 2Active Not RecruitingTreatmentAnaplastic Large Cell Lymphoma / Lymphoma, Hodgkins1
1, 2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Ovarian Cancer1
1, 2CompletedTreatmentBreast Cancer1
1, 2CompletedTreatmentFallopian Tube Cancer / Ovarian Cancer / Peritoneal Cavity Cancer1
1, 2CompletedTreatmentHodgkins Disease (HD) / Malignant Lymphomas1
1, 2CompletedTreatmentLeukemias / Malignant Lymphomas1
1, 2CompletedTreatmentLeukemias / Richter's Transformation1
1, 2CompletedTreatmentLymphoma, Hodgkins1
1, 2CompletedTreatmentMalignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentMetastatic Breast Cancer1
1, 2CompletedTreatmentMultiple Myeloma (MM)1
1, 2CompletedTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
1, 2Not Yet RecruitingTreatmentAutoimmune Diseases / Diabetes Mellitus (DM) / Hypoglycemia / Type 1 Insulin-Dependent Diabetes Mellitus1
1, 2RecruitingTreatmentAcute, recurrent Myeloid Leukemia / High Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Other Diseases of Blood and Blood-Forming Organs / Refractory Acute Myeloid Leukemia1
1, 2RecruitingTreatmentMalignant Lymphomas1
1, 2RecruitingTreatmentMetastatic Triple Negative Breast Cancer1
1, 2RecruitingTreatmentSarcomas1
1, 2TerminatedTreatmentAggressive Marginal Zone Lymphoma (MZL) / Burkitt Lymphoma (BL) / Follicular Lymphoma Grade III (FL III°) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Mantle Cell Lymphoma (MCL), Blastoid Variant1
1, 2TerminatedTreatmentHead and Neck Carcinoma1
1, 2TerminatedTreatmentMale Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2TerminatedTreatmentPain / Prostate Cancer1
1, 2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Extragonadal Germ Cell Tumor / Ovarian Cancer / Testicular germ cell tumour1
1, 2WithdrawnTreatmentNeutropenia, Severe Chronic1
2Active Not RecruitingOtherBreast Cancer / Locally Advanced Malignant Neoplasm1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Adenosquamous Lung Carcinoma / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Large Cell Lung Carcinoma / Lung Adenosquamous Carcinoma / Lung Large Cell Carcinoma / Lung Squamous Cell Carcinoma / Minimally Invasive Lung Adenocarcinoma / Squamous Cell Carcinoma of Lung / Squamous Cell Lung Carcinoma / Stage IIIA Lung Non-Small Cell Cancer AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Lung Non-Small Cell Cancer AJCC v7 / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v71
2Active Not RecruitingTreatmentBreast Cancer1
2Active Not RecruitingTreatmentLeukemias2
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
2Active Not RecruitingTreatmentMetastatic Colorectal Adenocarcinoma1
2Active Not RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2CompletedNot AvailableBreast Cancer1
2CompletedPreventionMultiple Myeloma (MM)1
2CompletedPreventionNeutropenia / Sarcomas1
2CompletedPreventionUnresectable Locally Advanced NSCLC1
2CompletedSupportive CareColorectal Cancers / Malignant Neoplasm of Colon / Rectal Carcinoma1
2CompletedSupportive CareLung Cancers1
2CompletedSupportive CareMalignant Lymphomas / Neutropenia1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Small Cell Carcinoma / Cervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma / Stage III Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-Small Cell Lung Cancer Recurrent / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2CompletedTreatmentAnemias / Drug/Agent Toxicity by Tissue/Organ / Lung Cancers / Neutropenia1
2CompletedTreatmentB-cell Non-Hodgkin's Lymphomas / Malignant Lymphomas1
2CompletedTreatmentBladder Cancers / Muscle-invasive Bladder Cancer1
2CompletedTreatmentBone Pain in Stage I - III Breast Cancer1
2CompletedTreatmentBrain and Central Nervous System Tumors / Extragonadal Germ Cell Tumor / Ovarian Cancer / Teratoma / Testicular germ cell tumour1
2CompletedTreatmentBreast Cancer6
2CompletedTreatmentBreast Cancer / Early Breast Cancer / Stage II Breast Cancer1
2CompletedTreatmentBreast Cancer / Fevers / Neutropenia1
2CompletedTreatmentBreast Cancer / Lung Cancers / Ovarian Cancer1
2CompletedTreatmentBreast Cancer / Metastatic Breast Cancer1
2CompletedTreatmentBreast Cancer / Neutropenia1
2CompletedTreatmentCancer of Head and Neck / Colorectal Cancers / Esophageal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Ovarian Cancer / Prostate Cancer1
2CompletedTreatmentContiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma1
2CompletedTreatmentContiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Stage I Mantle Cell Lymphoma / Stage III Mantle Cell Lymphoma / Stage IV Mantle Cell Lymphoma1
2CompletedTreatmentDistal Urethral Cancer / Metastatic Bladder Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Proximal Urethral Cancer / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Regional Transitional Cell Cancer of the Renal Pelvis and Ureter / Stage III Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Urethral Cancer Associated With Invasive Bladder Cancer1
2CompletedTreatmentEsophageal Cancers1
2CompletedTreatmentExtensive-Stage Small Cell Lung Cancer1
2CompletedTreatmentExtragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
2CompletedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cavity Cancer1
2CompletedTreatmentFemale Breast Cancer1
2CompletedTreatmentHER2-Positive Early Stage Breast Cancer1
2CompletedTreatmentHematological Neoplasms / Tumors1
2CompletedTreatmentHematology / Lymphoma, Hodgkins / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL) / Oncology1
2CompletedTreatmentLeukemias / Malignant Lymphomas1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2CompletedTreatmentMale Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer1
2CompletedTreatmentMalignant Lymphomas7
2CompletedTreatmentMalignant Lymphomas / Plasma Cell Myeloma1
2CompletedTreatmentMetastatic Breast Cancer1
2CompletedTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Carcinoma With Sarcomatoid Features1
2CompletedTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentMyeloid Leukemias1
2CompletedTreatmentNeutropenia2
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)4
2CompletedTreatmentOvarian Cancer / Peritoneal Cavity Cancer1
2CompletedTreatmentRecurrent Uterine Corpus Sarcoma / Uterine Corpus Leiomyosarcoma1
2CompletedTreatmentSarcomas3
2CompletedTreatmentTransitional Cell Carcinoma1
2CompletedTreatmentUntreated CD20-Positive Large B-Cell Lymphoma1
2CompletedTreatmentWilms' tumor1
2Not Yet RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Malignancies1
2RecruitingPreventionBreast Cancer / Neutropenia / Neutropenia, Febrile1
2RecruitingTreatmentAccelerated Phase Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Acute Lymphoblastic Leukaemia Recurrent / Acute Lymphoblastic Leukaemias (ALL) / Acute Myeloid Leukemia With BCR-ABL1 / Blast Phase Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Philadelphia Chromosome Positive / Refractory Acute Lymphoblastic Leukemia1
2RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / Acute Lymphoblastic Leukaemias (ALL) / Burkitt Leukemia/Lymphoma / Burkitt's Lymphoma / Hematopoietic/Lymphoid Cancer / High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements / Lymphoblastic lymphoma (Precursor T-lymphoblastic lymphoma/leukemia) refractory / Lymphoma, Lymphoblastic / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Burkitt Leukemia / Recurrent Burkitt Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements / Refractory Acute Lymphoblastic Leukemia / Refractory Burkitt Leukemia / Refractory Burkitt Lymphoma / Refractory High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias / Philadelphia Chromosome Negative / Recurrent B Acute Lymphoblastic Leukemia / Refractory B Acute Lymphoblastic Leukemia1
2RecruitingTreatmentAlcoholic Hepatitis (AH)1
2RecruitingTreatmentAplastic Anemia / De Novo Myelodysplastic Syndrome / Leukemias / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes1
2RecruitingTreatmentBreast Cancer / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentCastration-Resistant Prostate Cancer (CRPC) / Prostate Cancer1
2RecruitingTreatmentChemotherapy Induced Neutropenia1
2RecruitingTreatmentEarly Breast Cancer1
2RecruitingTreatmentHer2-Positive Breast Cancer / Operable Breast Cancer1
2RecruitingTreatmentInfiltrating Bladder Urothelial Carcinoma / Stage II Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma1
2RecruitingTreatmentLocally Advanced Breast Cancer (LABC)1
2RecruitingTreatmentLymphoma, Hodgkins1
2RecruitingTreatmentNeutropenia1
2RecruitingTreatmentPeripheral Blood Stem Cell Transplantation1
2RecruitingTreatmentRetinoblastoma1
2RecruitingTreatmentRhabdomyosarcomas1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Carcinoma, Head And Neck1
2RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)1
2TerminatedTreatmentBone Cancer / Ewing's Sarcoma (ES)1
2TerminatedTreatmentBrain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Malignant Lymphomas / Thrombocytopenia1
2TerminatedTreatmentBreast Cancer1
2TerminatedTreatmentBreast Cancer / Cancer of the Breast / Neoplasms, Breast / Tumors, Breast1
2TerminatedTreatmentHER2-Negative Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2TerminatedTreatmentHead and Neck Carcinoma1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2TerminatedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2TerminatedTreatmentMelanoma Metastatic1
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentOvarian Cancer1
2TerminatedTreatmentPreviously Treated Non Small Cell Lung Cancer1
2TerminatedTreatmentSolid Malignancies1
2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
2Unknown StatusTreatmentBreast Cancer1
2Unknown StatusTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
2Unknown StatusTreatmentMalignant Lymphomas2
2Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2Unknown StatusTreatmentSolid Malignancies1
2WithdrawnTreatmentAnterior Urethral Cancer / Localized Transitional Cell Cancer of the Renal Pelvis and Ureter / Posterior Urethral Cancer / Recurrent Bladder Cancer / Recurrent Urethral Cancer / Regional Transitional Cell Cancer of the Renal Pelvis and Ureter / Stage III Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Ureteral Cancer / Urethral Cancer Associated With Invasive Bladder Cancer1
2, 3Active Not RecruitingSupportive CareChemotherapy Induced Neutropenia2
2, 3CompletedPreventionChemotherapy Induced Neutropenia1
2, 3CompletedSupportive CareChemotherapy Induced Neutropenia1
2, 3CompletedTreatmentLeukemia Acute Myeloid Leukemia (AML)1
3Active Not RecruitingTreatmentBreast Cancer3
3Active Not RecruitingTreatmentBreast Cancer / Neutropenia2
3Active Not RecruitingTreatmentEndometrial Cancer / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IVA Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer AJCC v71
3Active Not RecruitingTreatmentLarge B Cell Lymphoma1
3Active Not RecruitingTreatmentLocally Advanced or Metastatic Non Small Cell Lung Cancer Stage IIIb - IV1
3Active Not RecruitingTreatmentMalignant Lymphomas2
3Active Not RecruitingTreatmentStage I Uterine Sarcoma / Stage I Uterine Sarcoma AJCC v7 / Uterine Corpus Leiomyosarcoma1
3Active Not RecruitingTreatmentTriple Negative Breast Neoplasms1
3CompletedPreventionBreast Cancer / Cancer treatment / Neutropenia, Febrile1
3CompletedPreventionMalignant Neoplasm of Female Breast1
3CompletedPreventionNeutropenia1
3CompletedSupportive CareBreast Cancer Patients Treated With Myelosuppressive Chemotherapy / Neutropenic Complications1
3CompletedSupportive CareBreast Cancer / Chemotherapy Induced Neutropenia1
3CompletedSupportive CareChemotherapy Induced Neutropenia1
3CompletedSupportive CareColorectal Cancers / Fevers / Locally Advanced / Malignancies / Malignant Neoplasm of Colon / Metastatic Colorectal Cancer (MCRC) / Neutropenia / Rectal Carcinoma1
3CompletedTreatmentAggressive B Cell Non-Hodgkin Lymphomas at High Risk for R-CHOP-21-induced Neutropenia1
3CompletedTreatmentBreast Cancer4
3CompletedTreatmentChemotherapy-Induced Febrile Neutropenia / Neoplasms, Breast1
3CompletedTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Endometrioid Adenocarcinoma, Variant With Squamous Differentiation / Endometrial Serous Adenocarcinoma / Stage III Uterine Corpus Cancer1
3CompletedTreatmentSarcomas1
3Not Yet RecruitingPreventionMalignant Lymphomas / Neutropenia1
3RecruitingPreventionBreast Cancer1
3RecruitingTreatmentAnn Arbor Stage III Hodgkin Lymphoma / Ann Arbor Stage III Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage III Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage III Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IIIA Hodgkin Lymphoma / Ann Arbor Stage IIIB Hodgkin Lymphoma / Ann Arbor Stage IV Hodgkin Lymphoma / Ann Arbor Stage IV Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage IV Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage IV Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IVA Hodgkin Lymphoma / Ann Arbor Stage IVB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Lymphocyte-Rich Classic Hodgkin Lymphoma1
3RecruitingTreatmentBreast Cancer / Neutropenia1
3RecruitingTreatmentGerm Cell Tumors1
3RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)1
3TerminatedTreatmentLung Cancers1
3TerminatedTreatmentMultiple Myeloma (MM)1
3TerminatedTreatmentRecurrent Uterine Corpus Sarcoma / Stage IIIA Uterine Sarcoma / Stage IIIB Uterine Sarcoma / Stage IIIC Uterine Sarcoma / Stage IVA Uterine Sarcoma / Stage IVB Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3Unknown StatusTreatmentBreast Cancer2
3Unknown StatusTreatmentIPI≥2 / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
3WithdrawnTreatmentBreast Cancer1
4CompletedPreventionBreast Cancer2
4CompletedPreventionBreast Cancer / Lung Cancers / Neutropenia / Non-Hodgkin's Lymphoma (NHL) / Ovarian Cancer1
4CompletedPreventionMalignant Lymphomas1
4CompletedPreventionMalignant Solid Tumours1
4CompletedTreatmentBreast Cancer1
4CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
4CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
4Unknown StatusSupportive CareBreast Cancer / Neutropenia1
Not AvailableActive Not RecruitingNot AvailableBreast Cancer / Lung Cancers1
Not AvailableActive Not RecruitingDiagnosticSarcomas1
Not AvailableCompletedPreventionSarcomas1
Not AvailableCompletedTreatmentBreast Cancer2
Not AvailableCompletedTreatmentCoronary Artery Disease1
Not AvailableNot Yet RecruitingNot AvailableBreast1
Not AvailableRecruitingNot AvailableNeutropenia1
Not AvailableRecruitingTreatmentMalignant Lymphomas1
Not AvailableRecruitingTreatmentMetastatic Pheochromocytoma / Relapsed Neuroblastoma1
Not AvailableTerminatedTreatmentMalignancies, Hematologic1
Not AvailableTerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)1
Not AvailableUnknown StatusTreatmentBreast Cancer1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Amgen Inc.
  • Physicians Total Care Inc.
Dosage forms
FormRouteStrength
SolutionSubcutaneous
InjectionSubcutaneous6 mg/0.6mL
KitSubcutaneous6 mg/0.6mL
SolutionSubcutaneous10 mg
Injection, solutionSubcutaneous6 mg
Injection, solutionSubcutaneous6 mg/0.6mL
Prices
Unit descriptionCostUnit
Neulasta 6 mg/0.6 ml syringe4102.37USD syringe
Neulasta 6 mg/0.6ml Solution 0.6ml Syringe4026.05USD syringe
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341537No2007-07-312024-07-31Canada
CA1339071No1997-07-292014-07-29Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)60 °CLuo, P., Protein Science 11:1218-1226 (2002)

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Agonist
General Function
Receptor activity
Specific Function
Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutroph...
Gene Name
CSF3R
Uniprot ID
Q99062
Uniprot Name
Granulocyte colony-stimulating factor receptor
Molecular Weight
92155.615 Da
References
  1. Erkeland SJ, Aarts LH, Irandoust M, Roovers O, Klomp A, Valkhof M, Gits J, Eyckerman S, Tavernier J, Touw IP: Novel role of WD40 and SOCS box protein-2 in steady-state distribution of granulocyte colony-stimulating factor receptor and G-CSF-controlled proliferation and differentiation signaling. Oncogene. 2007 Mar 29;26(14):1985-94. Epub 2006 Sep 25. [PubMed:17001306]
  2. Elsasser A, Franzen M, Kohlmann A, Weisser M, Schnittger S, Schoch C, Reddy VA, Burel S, Zhang DE, Ueffing M, Tenen DG, Hiddemann W, Behre G: The fusion protein AML1-ETO in acute myeloid leukemia with translocation t(8;21) induces c-jun protein expression via the proximal AP-1 site of the c-jun promoter in an indirect, JNK-dependent manner. Oncogene. 2003 Aug 28;22(36):5646-57. [PubMed:12944913]
  3. Ward AC: The role of the granulocyte colony-stimulating factor receptor (G-CSF-R) in disease. Front Biosci. 2007 Jan 1;12:608-18. [PubMed:17127322]
  4. Zhuang D, Qiu Y, Haque SJ, Dong F: Tyrosine 729 of the G-CSF receptor controls the duration of receptor signaling: involvement of SOCS3 and SOCS1. J Leukoc Biol. 2005 Oct;78(4):1008-15. Epub 2005 Jul 20. [PubMed:16033816]
  5. Cao YR, Shao ZH, Liu H, Shi J, Bai J, Tu MF, Wang HQ, Xing LM, Cui ZZ, Sun J, Jia HR, Yang TY: [The response of bone marrow hematopoietic cells to G-CSF in paroxysmal nocturnal hemoglobinuria patients]. Zhonghua Xue Ye Xue Za Zhi. 2005 Apr;26(4):235-8. [PubMed:15949269]
  6. Kotto-Kome AC, Fox SE, Lu W, Yang BB, Christensen RD, Calhoun DA: Evidence that the granulocyte colony-stimulating factor (G-CSF) receptor plays a role in the pharmacokinetics of G-CSF and PegG-CSF using a G-CSF-R KO model. Pharmacol Res. 2004 Jul;50(1):55-8. [PubMed:15082029]

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
No
Actions
Substrate
General Function
Serine-type endopeptidase activity
Specific Function
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis.
Gene Name
ELANE
Uniprot ID
P08246
Uniprot Name
Neutrophil elastase
Molecular Weight
28517.81 Da
References
  1. Carter CR, Whitmore KM, Thorpe R: The significance of carbohydrates on G-CSF: differential sensitivity of G-CSFs to human neutrophil elastase degradation. J Leukoc Biol. 2004 Mar;75(3):515-22. Epub 2003 Dec 4. [PubMed:14657210]
  2. Jian MY, Koizumi T, Tsushima K, Fujimoto K, Kubo K: Effects of granulocyte colony-stimulating factor (G-CSF) and neutrophil elastase inhibitor (ONO-5046) on acid-induced lung injury in rats. Inflammation. 2004 Dec;28(6):327-36. [PubMed:16245075]
  3. Pelus LM, Bian H, King AG, Fukuda S: Neutrophil-derived MMP-9 mediates synergistic mobilization of hematopoietic stem and progenitor cells by the combination of G-CSF and the chemokines GRObeta/CXCL2 and GRObetaT/CXCL2delta4. Blood. 2004 Jan 1;103(1):110-9. Epub 2003 Sep 4. [PubMed:12958067]
  4. Druhan LJ, Ai J, Massullo P, Kindwall-Keller T, Ranalli MA, Avalos BR: Novel mechanism of G-CSF refractoriness in patients with severe congenital neutropenia. Blood. 2005 Jan 15;105(2):584-91. Epub 2004 Sep 7. [PubMed:15353486]
  5. Schepers H, Wierenga AT, van Gosliga D, Eggen BJ, Vellenga E, Schuringa JJ: Reintroduction of C/EBPalpha in leukemic CD34+ stem/progenitor cells impairs self-renewal and partially restores myelopoiesis. Blood. 2007 Aug 15;110(4):1317-25. Epub 2007 May 2. [PubMed:17475913]
  6. Abdolzade-Bavil A, von Kerczek A, Cooksey BA, Kaufman T, Krasney PA, Pukac L, Gorlach M, Lammerich A, Scheckermann C, Allgaier H, Shen WD, Liu PM: Differential sensitivity of lipegfilgrastim and pegfilgrastim to neutrophil elastase correlates with differences in clinical pharmacokinetic profile. J Clin Pharmacol. 2016 Feb;56(2):186-94. doi: 10.1002/jcph.578. Epub 2015 Sep 1. [PubMed:26105553]

Drug created on June 13, 2005 07:24 / Updated on December 07, 2019 14:15