You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NamePegfilgrastim
Accession NumberDB00019  (BTD00094, BIOD00094)
TypeBiotech
GroupsApproved
DescriptionPEGylated (at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.
Protein structureDb00019
Related Articles
Protein chemical formulaC845H1343N223O243S9
Protein average weight18802.8 Da
Sequences
> Pegfilgrastim sequence
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA
PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ
QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Download FASTA Format
Synonyms
Granulocyte colony-stimulating factor pegfilgrastim
Peg-filgrastim
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
NeulastaSolution10 mgSubcutaneousAmgen2004-03-12Not applicableCanada
NeulastaInjection6 mg/.6mLSubcutaneousAmgen2002-04-01Not applicableUs
NeulastaKitSubcutaneousAmgen2002-04-01Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-22Not applicableEu
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-22Not applicableEu
NeupopegInjection, solution6 mgSubcutaneousDompé Biotec S.P.A.2002-08-22Not applicableEu
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII3A58010674
CAS number208265-92-3
Pharmacology
IndicationIncreases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant.
Structured Indications
PharmacodynamicsUsed in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment, and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.
Mechanism of actionPegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrow storage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase.
TargetKindPharmacological actionActionsOrganismUniProt ID
Granulocyte colony-stimulating factor receptorProteinyes
agonist
HumanQ99062 details
Neutrophil elastaseProteinunknownNot AvailableHumanP08246 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationFilgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endocytosis, and subsequent degradation inside the cells. Pegylation of filgrastim renders renal clearance insignificant, which was demonstrated in bilaterally nephrectomized rats and confirmed in subjects with renal impairment. As a result, the neutrophil-mediated clearance is the predominant elimination pathway for pegfilgrastim. During chemotherapy-induced neutropenia, the clearance of pegfilgrastim is significantly reduced and the concentration of pegfilgrastim is sustained until onset of neutrophil recovery.
Half life15-80 hrs
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
PegloticaseThe therapeutic efficacy of Pegfilgrastim can be decreased when used in combination with Pegloticase.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Yang BB, Kido A: Pharmacokinetics and pharmacodynamics of pegfilgrastim. Clin Pharmacokinet. 2011 May;50(5):295-306. doi: 10.2165/11586040-000000000-00000. [PubMed:21456630 ]
External Links
ATC CodesL03AA13
AHFS Codes
  • 20:16.00
PDB Entries
FDA labelDownload (50 KB)
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1Active Not RecruitingNot AvailableNeutropenias1
1Active Not RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer1
1Active Not RecruitingTreatmentProstate Cancers1
1CompletedNot AvailableBioequivalence1
1CompletedNot AvailableHealthy1
1CompletedNot AvailableImmunity, Humoral1
1CompletedTreatmentAplastic Anaemia (AA)1
1CompletedTreatmentCancer, Advanced1
1CompletedTreatmentCancer, Advanced / Metastatic Cancers1
1CompletedTreatmentCrohn's Disease (CD)1
1CompletedTreatmentGlioblastomas / Gliosarcoma1
1CompletedTreatmentSystemic Sclerosis1
1CompletedTreatmentType 1 Diabetes Mellitus (T1DM)1
1RecruitingNot AvailableHealthy1
1RecruitingTreatmentGraft Versus Host Disease (GVHD) / Healthy / Lymphopenia1
1RecruitingTreatmentHodgkins Disease (HD) / Lymphoma, Large B-Cell, Diffuse / Lymphoma, T-Cell, Cutaneous / Lymphoma, T-Cell, Peripheral1
1RecruitingTreatmentNeoplasms Metastasis / Neoplasms, Colorectal1
1RecruitingTreatmentNeutropenias1
1RecruitingTreatmentProstate Cancers1
1TerminatedTreatmentLung Metastases / Osteosarcomas1
1WithdrawnTreatmentAcute Myeloid Leukaemias (AML)1
1, 2Active Not RecruitingTreatmentDiabetes Mellitus, Type 11
1, 2Active Not RecruitingTreatmentLymphoma, Hodgkins1
1, 2CompletedTreatmentAML / MDS1
1, 2CompletedTreatmentInfertility, Female1
1, 2CompletedTreatmentLeukemias / Richter's Transformation1
1, 2CompletedTreatmentLymphoma, B-Cell / Lymphoma, Large-Cell, Diffuse1
1, 2CompletedTreatmentMetastatic Breast Cancer (MBC)1
1, 2CompletedTreatmentPain / Prostate Cancers1
1, 2Not Yet RecruitingTreatmentAutoimmune Diseases / Diabetes Mellitus (DM) / Diabetes Mellitus, Type 1 / Hypoglycemia1
1, 2Not Yet RecruitingTreatmentCritical Limb Ischemia (CLI) / Diabetic Foot / Leg Ulcers1
1, 2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
1, 2RecruitingTreatmentAcute Myeloblastic Leukemia1
1, 2RecruitingTreatmentAnaplastic Large Cell Lymphoma / Lymphoma, Hodgkins1
1, 2RecruitingTreatmentCentral Nervous System Embryonal Tumor / Germ Cell Tumors1
1, 2RecruitingTreatmentDiffuse Large B Cell Lymphoma Refractory / Diffuse Large B Cell Lymphoma Relapsed1
1, 2RecruitingTreatmentSarcomas1
1, 2TerminatedTreatmentInfertility, Female1
2Active Not RecruitingTreatmentAcute Myeloid Leukaemias (AML)1
2Active Not RecruitingTreatmentBladder Cancers / Muscle-invasive Bladder Cancer1
2Active Not RecruitingTreatmentCarcinoma, Urothelial1
2Active Not RecruitingTreatmentHER2-Positive Early Stage Breast Cancer1
2Active Not RecruitingTreatmentLymphoma, Hodgkins1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
2CompletedNot AvailableCancer, Breast1
2CompletedPreventionMultiple Myeloma (MM)1
2CompletedPreventionNeutropenias / Sarcomas1
2CompletedSupportive CareColon Cancer / Colorectal Cancers / Rectal Cancers1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2CompletedTreatmentAplastic Anaemia (AA) / Myelodysplastic Syndrome1
2CompletedTreatmentBlood Cancers / Leukemias2
2CompletedTreatmentCancer of Head and Neck / Cancer, Ovarian / Colorectal Cancers / Esophageal Cancers / Gastric Cancers / Non Small Cell Lung Cancer (NSCLC) / Prostate Cancers1
2CompletedTreatmentCancer, Breast3
2CompletedTreatmentCancer, Breast / Cancer, Ovarian / Lung Cancers1
2CompletedTreatmentCancer, Breast / Fevers / Neutropenias1
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentCancer, Breast / Neoplasms, Breast1
2CompletedTreatmentCancer, Breast / Stage I Breast Cancer / Stage II Breast Cancer1
2CompletedTreatmentCarcinoma of Head/Neck / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentChemotherapy Induced Neutropenia1
2CompletedTreatmentDiamond Blackfan Anemia1
2CompletedTreatmentDistal Urethral Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Proximal Urethral Cancer / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Regional Transitional Cell Cancer of the Renal Pelvis and Ureter / Stage III Bladder Cancer / Stage IV Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Urethral Cancer Associated With Invasive Bladder Cancer1
2CompletedTreatmentExtensive-Stage Small Cell Lung Cancer1
2CompletedTreatmentFemale Breast Cancer1
2CompletedTreatmentHematological Neoplasms / Tumors1
2CompletedTreatmentHodgkins Disease (HD) / Leukaemia, Lymphoblastic / Multiple Myeloma (MM) / Myelogenous Leukemia / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentLeukemia, Myelocytic, Acute1
2CompletedTreatmentLeukemias / Lymphoma NOS1
2CompletedTreatmentLymphoma NOS1
2CompletedTreatmentMetastatic Breast Cancer (MBC)1
2CompletedTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Carcinoma With Sarcomatoid Features1
2CompletedTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentMyeloid Leukemias1
2CompletedTreatmentNeoplasms, Breast1
2CompletedTreatmentNeoplasms, Ovarian1
2CompletedTreatmentNeuroblastomas / Rhabdomyosarcomas / Sarcoma, Ewing's1
2CompletedTreatmentNeutropenias2
2CompletedTreatmentNon Small Cell Lung Cancer (NSCLC)1
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)4
2CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentPreviously Treated Non Small Cell Lung Cancer1
2Not Yet RecruitingPreventionCancer, Breast / Febrile Neutropenia / Neutropenias1
2Not Yet RecruitingTreatmentEarly Stage Breast Cancer1
2Not Yet RecruitingTreatmentSolid Malignancies1
2RecruitingNot AvailableCancer, Breast / Locally Advanced Malignant Neoplasm1
2RecruitingTreatmentBortezomib / Cyclophosphamide / Dexamethasone / Granulocyte Colony-Stimulating Factor / Myelomas1
2RecruitingTreatmentChronic Chagasic Myocarditis1
2RecruitingTreatmentDiabetes Mellitus, Type 11
2RecruitingTreatmentDiffuse Large B Cell Lymphoma (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentDiffuse Large B-Cell Lymphoma (DLBCL)1
2RecruitingTreatmentLeukemias5
2RecruitingTreatmentLymphoma NOS2
2RecruitingTreatmentLymphoma, Hodgkins1
2RecruitingTreatmentProstate Cancers1
2RecruitingTreatmentRetinoblastoma1
2RecruitingTreatmentRhabdomyosarcomas1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Carcinoma, Head And Neck1
2TerminatedTreatmentBone Cancer / Sarcoma, Ewing's1
2TerminatedTreatmentBrain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Lymphoma NOS / Thrombocytopenias1
2TerminatedTreatmentCancer, Ovarian1
2TerminatedTreatmentHematologic Diseases1
2TerminatedTreatmentMelanoma Metastatic1
2TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)3
2TerminatedTreatmentSolid Malignancies1
2, 3Active Not RecruitingTreatmentDe Novo Akute Myeloid Leukemia (AML) / Refractory Anemia With Excess of Blasts in Transformation / Secondary Acute Myeloid Leukemia (AML)1
2, 3CompletedSupportive CareChemotherapy-Induced Neutropenia1
2, 3CompletedTreatmentAcute Myeloid Leukaemias (AML)1
2, 3CompletedTreatmentChronic Ischaemic Heart Failure1
2, 3RecruitingTreatmentCastrate Resistant Prostate Cancer (CRPC)1
2, 3RecruitingTreatmentLiver Cirrhosis1
2, 3TerminatedTreatmentAML / Leukemia, Lymphocytic, Acute / MDS1
3Active Not RecruitingTreatmentCancer, Breast1
3Active Not RecruitingTreatmentDiffuse Large B-Cell Lymphoma (DLBCL) / IPI≥21
3Active Not RecruitingTreatmentLarge B Cell Lymphoma1
3CompletedPreventionNeutropenias1
3CompletedSupportive CareBreast Cancer Patients Treated With Myelosuppressive Chemotherapy / Neutropenic Complications1
3CompletedSupportive CareCancer, Breast / Chemotherapy-Induced Neutropenia1
3CompletedSupportive CareCancers / Colon Cancer / Colorectal Cancers / Fevers / Locally Advanced / Metastatic Colorectal Cancers / Neutropenias / Rectal Cancers1
3CompletedTreatmentAcute Myeloid Leukaemias (AML)1
3CompletedTreatmentCancer, Breast4
3CompletedTreatmentChemotherapy Induced Neutropenia1
3CompletedTreatmentDiffuse Large B Cell Lymphoma (DLBCL) / Elderly Patients (>65 Years)1
3Not Yet RecruitingPreventionLymphoma NOS / Neutropenias1
3RecruitingTreatmentAcute Myeloid Leukaemias (AML)1
3RecruitingTreatmentAggressive B Cell Non-Hodgkin Lymphomas at High Risk for R-CHOP-21-induced Neutropenia1
3RecruitingTreatmentCancer, Breast / Neutropenias1
3RecruitingTreatmentChildhood Teratoma / Choriocarcinoma / Extragonadal Seminoma / Germ Cell Tumors / Germinoma / Malignant Germ Cell Neoplasm / Mixed Germ Cell Tumor / Non-seminomatous Germ Cell Tumors / Seminoma / Teratoma / Yolk Sac Tumor1
3RecruitingTreatmentGerm Cell Tumors1
3RecruitingTreatmentLymphoma, Mantle-Cell1
3RecruitingTreatmentMyelokathexis / Neutropenias / Warts / WHIMS1
3RecruitingTreatmentWomen With Recurrent Implantation Failure (Three Previous IVF Attempts Failed and at Least 8 Good Embryos Replaced1
3TerminatedPreventionCancer treatment / Cancer, Breast / Febrile Neutropenia1
3TerminatedTreatmentAplastic Anaemia (AA)1
4CompletedPreventionCancer, Breast / Cancer, Ovarian / Lung Cancers / Neutropenias / Non-Hodgkin's Lymphoma (NHL)1
4CompletedTreatmentAbortion, Habitual1
4CompletedTreatmentAcute Myeloblastic Leukemia / Myelodysplastic Syndrome1
4CompletedTreatmentAdult Acute Lymphocytic Leukemia2
4CompletedTreatmentLymphoma, Lymphoblastic1
4CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
4CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
4RecruitingTreatmentAcute Myeloid Leukaemias (AML)1
4RecruitingTreatmentAdult Acute Lymphocytic Leukemia1
4RecruitingTreatmentAlcoholic Liver Diseases / Hepatitis B / Liver Failure1
4RecruitingTreatmentBurkitt's Leukemia / Burkitt's Lymphoma / Large Cell Anaplastic Lymphoma / Lymphoma, Lymphoblastic / Mediastinal Neoplasms1
Not AvailableActive Not RecruitingTreatmentMyelomas1
Not AvailableCompletedPreventionSarcomas1
Not AvailableCompletedTreatmentCancer, Breast1
Not AvailableCompletedTreatmentCirrhosis, Decompensated1
Not AvailableCompletedTreatmentMyocardial Infarction (MI)1
Not AvailableRecruitingNot AvailableCancer, Breast1
Not AvailableRecruitingTreatmentLymphoma NOS1
Not AvailableRecruitingTreatmentMetastatic Pheochromocytoma / Relapsed Neuroblastoma1
Not AvailableRecruitingTreatmentSevere Alcoholic Hepatitis1
Not AvailableTerminatedNot AvailableAcute Myeloid Leukaemias (AML)1
Not AvailableTerminatedTreatmentMalignancies, Hematologic1
Not AvailableTerminatedTreatmentNon Hodgkin Lymphoma (NHL)1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
InjectionSubcutaneous6 mg/.6mL
KitSubcutaneous
SolutionSubcutaneous10 mg
Injection, solutionSubcutaneous6 mg
Prices
Unit descriptionCostUnit
Neulasta 6 mg/0.6 ml syringe4102.37USD syringe
Neulasta 6 mg/0.6ml Solution 0.6ml Syringe4026.05USD syringe
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339071 No1997-07-292014-07-29Canada
CA1341537 No2007-07-312024-07-31Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point60 °CLuo, P., Protein Science 11:1218-1226 (2002)
hydrophobicity0.209Not Available
isoelectric point5.65Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
Gene Name:
CSF3R
Uniprot ID:
Q99062
Molecular Weight:
92155.615 Da
References
  1. Erkeland SJ, Aarts LH, Irandoust M, Roovers O, Klomp A, Valkhof M, Gits J, Eyckerman S, Tavernier J, Touw IP: Novel role of WD40 and SOCS box protein-2 in steady-state distribution of granulocyte colony-stimulating factor receptor and G-CSF-controlled proliferation and differentiation signaling. Oncogene. 2007 Mar 29;26(14):1985-94. Epub 2006 Sep 25. [PubMed:17001306 ]
  2. Elsasser A, Franzen M, Kohlmann A, Weisser M, Schnittger S, Schoch C, Reddy VA, Burel S, Zhang DE, Ueffing M, Tenen DG, Hiddemann W, Behre G: The fusion protein AML1-ETO in acute myeloid leukemia with translocation t(8;21) induces c-jun protein expression via the proximal AP-1 site of the c-jun promoter in an indirect, JNK-dependent manner. Oncogene. 2003 Aug 28;22(36):5646-57. [PubMed:12944913 ]
  3. Ward AC: The role of the granulocyte colony-stimulating factor receptor (G-CSF-R) in disease. Front Biosci. 2007 Jan 1;12:608-18. [PubMed:17127322 ]
  4. Zhuang D, Qiu Y, Haque SJ, Dong F: Tyrosine 729 of the G-CSF receptor controls the duration of receptor signaling: involvement of SOCS3 and SOCS1. J Leukoc Biol. 2005 Oct;78(4):1008-15. Epub 2005 Jul 20. [PubMed:16033816 ]
  5. Cao YR, Shao ZH, Liu H, Shi J, Bai J, Tu MF, Wang HQ, Xing LM, Cui ZZ, Sun J, Jia HR, Yang TY: [The response of bone marrow hematopoietic cells to G-CSF in paroxysmal nocturnal hemoglobinuria patients]. Zhonghua Xue Ye Xue Za Zhi. 2005 Apr;26(4):235-8. [PubMed:15949269 ]
  6. Kotto-Kome AC, Fox SE, Lu W, Yang BB, Christensen RD, Calhoun DA: Evidence that the granulocyte colony-stimulating factor (G-CSF) receptor plays a role in the pharmacokinetics of G-CSF and PegG-CSF using a G-CSF-R KO model. Pharmacol Res. 2004 Jul;50(1):55-8. [PubMed:15082029 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis.
Gene Name:
ELANE
Uniprot ID:
P08246
Molecular Weight:
28517.81 Da
References
  1. Carter CR, Whitmore KM, Thorpe R: The significance of carbohydrates on G-CSF: differential sensitivity of G-CSFs to human neutrophil elastase degradation. J Leukoc Biol. 2004 Mar;75(3):515-22. Epub 2003 Dec 4. [PubMed:14657210 ]
  2. Jian MY, Koizumi T, Tsushima K, Fujimoto K, Kubo K: Effects of granulocyte colony-stimulating factor (G-CSF) and neutrophil elastase inhibitor (ONO-5046) on acid-induced lung injury in rats. Inflammation. 2004 Dec;28(6):327-36. [PubMed:16245075 ]
  3. Pelus LM, Bian H, King AG, Fukuda S: Neutrophil-derived MMP-9 mediates synergistic mobilization of hematopoietic stem and progenitor cells by the combination of G-CSF and the chemokines GRObeta/CXCL2 and GRObetaT/CXCL2delta4. Blood. 2004 Jan 1;103(1):110-9. Epub 2003 Sep 4. [PubMed:12958067 ]
  4. Druhan LJ, Ai J, Massullo P, Kindwall-Keller T, Ranalli MA, Avalos BR: Novel mechanism of G-CSF refractoriness in patients with severe congenital neutropenia. Blood. 2005 Jan 15;105(2):584-91. Epub 2004 Sep 7. [PubMed:15353486 ]
  5. Schepers H, Wierenga AT, van Gosliga D, Eggen BJ, Vellenga E, Schuringa JJ: Reintroduction of C/EBPalpha in leukemic CD34+ stem/progenitor cells impairs self-renewal and partially restores myelopoiesis. Blood. 2007 Aug 15;110(4):1317-25. Epub 2007 May 2. [PubMed:17475913 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on January 03, 2017 10:41