Interferon alfa

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
Interferon alfa
Accession Number
DB05258
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Interferons
Description

Natural interferon alpha or Multiferon is obtained from the leukocyte fraction of human blood following induction with Sendai virus. Interferon alfa contains several naturally occurring IFN-α subtypes and is purified by affinity chromatography. Interferon alpha proteins are mainly involved in innate immune response against viral infection. They come in 13 subtypes that are called IFNA1, IFNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, IFNA14, IFNA16, IFNA17, IFNA21. Multiferon consists of the 6 major subtypes are IFN-α1, IFN-α2, IFN-α8, IFN-α10, IFN-α14 and IFN-α21. Of these, IFN-α2 and IFN-α14 are glycosylated.

Protein structure
Db05258
Protein chemical formula
Not Available
Protein average weight
20700.0 Da (range 19300-22100)
Sequences
>Inteferon alpha-1
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHEL
IQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAV
KKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
>Inteferon alpha-2
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
>Interferon alpha-8
CDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQFQKAQAISVLHEM
IQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSILAV
RKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE
>Interferon alpha-10
CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEM
IQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAV
RKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
>Interferon alpha-14
CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEM
MQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAV
KKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
>Interferon alpha-21
CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEM
IQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAV
KKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Download FASTA Format
Synonyms
  • HuIFN-alpha-Le
  • IFN-α
  • Interferon alfa
  • Natural alpha interferon
International/Other Brands
Multiferon
Categories
UNII
Not Available
CAS number
Not Available

Pharmacology

Indication

Investigated for use/treatment in hepatitis (viral, C), leukemia (lymphoid), leukemia (myeloid), leukemia (unspecified), and melanoma.

Pharmacodynamics
Not Available
Mechanism of action

Natural alpha interferon offers multiple subtypes of interferon which may work together as a 'cocktail-in-one', while recombinant versions only exhibit a single subtype." Viragen offers MultiferonT at a cost which is competitive with recombinant interferon regimens.

Natural alpha interferon contains the multiple subtype composition that is characteristic of interferon produced by the human body. It is believed that this results in a broader spectrum of specific anti-viral and immunoregulatory activity with the subtypes acting synergistically to give a wide-ranging response.

TargetActionsOrganism
UInterferon alpha/beta receptor 1Not AvailableHumans
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Proteolyzed by endogenous proteases.

Route of elimination

Reticulo-endothilial system, kidneys and liver.

Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
(R)-warfarinThe risk or severity of bleeding can be increased when (R)-warfarin is combined with Interferon alfa.
(S)-WarfarinThe risk or severity of bleeding can be increased when (S)-Warfarin is combined with Interferon alfa.
2-MethoxyethanolThe risk or severity of adverse effects can be increased when 2-Methoxyethanol is combined with Interferon alfa.
3-isobutyl-1-methyl-7H-xanthineThe metabolism of 3-isobutyl-1-methyl-7H-xanthine can be decreased when combined with Interferon alfa.
3,5-diiodothyropropionic acidThe therapeutic efficacy of 3,5-diiodothyropropionic acid can be decreased when used in combination with Interferon alfa.
4-hydroxycoumarinThe risk or severity of bleeding can be increased when 4-hydroxycoumarin is combined with Interferon alfa.
6-O-benzylguanineThe metabolism of 6-O-benzylguanine can be decreased when combined with Interferon alfa.
7-DeazaguanineThe metabolism of 7-Deazaguanine can be decreased when combined with Interferon alfa.
7,9-DimethylguanineThe metabolism of 7,9-Dimethylguanine can be decreased when combined with Interferon alfa.
8-azaguanineThe metabolism of 8-azaguanine can be decreased when combined with Interferon alfa.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Yonezawa A, Morita R, Takaori-Kondo A, Kadowaki N, Kitawaki T, Hori T, Uchiyama T: Natural alpha interferon-producing cells respond to human immunodeficiency virus type 1 with alpha interferon production and maturation into dendritic cells. J Virol. 2003 Mar;77(6):3777-84. [PubMed:12610152]
External Links
PubChem Substance
347910052
Wikipedia
Interferon

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2CompletedTreatmentMelanoma (Skin)1
2CompletedTreatmentBrain and Central Nervous System Tumors1
2CompletedTreatmentHepatitis C Viral Infection1
2CompletedTreatmentLeukemias1
2CompletedTreatmentLocoregional Metastases in Malignant Melanoma Stages IIIB/C1
2CompletedTreatmentLung Cancers1
2CompletedTreatmentSarcoma, Osteogenic1
2Unknown StatusTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2, 3CompletedTreatmentCarcinoma of Urinary Bladder, Superficial1
3CompletedTreatmentHepatitis C Viral Infection1
3CompletedTreatmentMelanoma (Skin)1
3CompletedTreatmentMetastatic Renal Cell Carcinoma1
3CompletedTreatmentMultiple Myeloma (MM)1
3CompletedTreatmentNeoplasms, Kidney / Renal Cell Adenocarcinoma1
Not AvailableCompletedNot AvailableMelanoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Type i interferon receptor activity
Specific Function
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JA...
Gene Name
IFNAR1
Uniprot ID
P17181
Uniprot Name
Interferon alpha/beta receptor 1
Molecular Weight
63524.81 Da

Drug created on November 18, 2007 11:22 / Updated on June 04, 2019 06:15