Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Interferon alfa
Accession Number
DB05258
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Interferons
Description

Natural interferon alpha or Multiferon is obtained from the leukocyte fraction of human blood following induction with Sendai virus. Interferon alfa contains several naturally occurring IFN-α subtypes and is purified by affinity chromatography. Interferon alpha proteins are mainly involved in innate immune response against viral infection. They come in 13 subtypes that are called IFNA1, IFNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, IFNA14, IFNA16, IFNA17, IFNA21. Multiferon consists of the 6 major subtypes are IFN-α1, IFN-α2, IFN-α8, IFN-α10, IFN-α14 and IFN-α21. Of these, IFN-α2 and IFN-α14 are glycosylated.

Protein structure
Db05258
Protein chemical formula
Not Available
Protein average weight
20700.0 Da (range 19300-22100)
Sequences
>Inteferon alpha-1
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHEL
IQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAV
KKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
>Inteferon alpha-2
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
>Interferon alpha-8
CDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQFQKAQAISVLHEM
IQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSILAV
RKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE
>Interferon alpha-10
CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEM
IQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAV
RKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
>Interferon alpha-14
CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEM
MQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAV
KKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
>Interferon alpha-21
CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEM
IQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAV
KKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Download FASTA Format
Synonyms
  • HuIFN-alpha-Le
  • IFN-α
  • Interferon alfa
  • Natural alpha interferon
International/Other Brands
Multiferon
Categories
UNII
Not Available
CAS number
Not Available

Pharmacology

Indication

Investigated for use/treatment in hepatitis (viral, C), leukemia (lymphoid), leukemia (myeloid), leukemia (unspecified), and melanoma.

Pharmacodynamics
Not Available
Mechanism of action

Natural alpha interferon offers multiple subtypes of interferon which may work together as a 'cocktail-in-one', while recombinant versions only exhibit a single subtype." Viragen offers MultiferonT at a cost which is competitive with recombinant interferon regimens.

Natural alpha interferon contains the multiple subtype composition that is characteristic of interferon produced by the human body. It is believed that this results in a broader spectrum of specific anti-viral and immunoregulatory activity with the subtypes acting synergistically to give a wide-ranging response.

TargetActionsOrganism
UInterferon alpha/beta receptor 1Not AvailableHumans
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Proteolyzed by endogenous proteases.

Route of elimination

Reticulo-endothilial system, kidneys and liver.

Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
(R)-warfarinThe metabolism of (R)-warfarin can be decreased when combined with Interferon alfa.
(S)-WarfarinThe risk or severity of bleeding can be increased when (S)-Warfarin is combined with Interferon alfa.
2-MethoxyethanolThe risk or severity of adverse effects can be increased when 2-Methoxyethanol is combined with Interferon alfa.
3-isobutyl-1-methyl-7H-xanthineThe metabolism of 3-isobutyl-1-methyl-7H-xanthine can be decreased when combined with Interferon alfa.
3,5-diiodothyropropionic acidThe therapeutic efficacy of 3,5-diiodothyropropionic acid can be decreased when used in combination with Interferon alfa.
3,5-DiiodotyrosineThe therapeutic efficacy of 3,5-Diiodotyrosine can be decreased when used in combination with Interferon alfa.
4-hydroxycoumarinThe risk or severity of bleeding can be increased when 4-hydroxycoumarin is combined with Interferon alfa.
6-O-benzylguanineThe metabolism of 6-O-benzylguanine can be decreased when combined with Interferon alfa.
7-DeazaguanineThe metabolism of 7-Deazaguanine can be decreased when combined with Interferon alfa.
7,9-DimethylguanineThe metabolism of 7,9-Dimethylguanine can be decreased when combined with Interferon alfa.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Yonezawa A, Morita R, Takaori-Kondo A, Kadowaki N, Kitawaki T, Hori T, Uchiyama T: Natural alpha interferon-producing cells respond to human immunodeficiency virus type 1 with alpha interferon production and maturation into dendritic cells. J Virol. 2003 Mar;77(6):3777-84. [PubMed:12610152]
External Links
PubChem Substance
347910052
Wikipedia
Interferon

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0RecruitingTreatmentAnatomic Stage IV Breast Cancer AJCC / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Triple -Negative Breast Cancer1
1CompletedTreatmentAdult Solid Neoplasm1
1CompletedTreatmentBladder Cancers / Urethral Cancer1
1CompletedTreatmentChronic Myeloid Leukemia (CML)1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Precancerous Conditions / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentMelanoma2
1CompletedTreatmentMelanoma (Skin) / Renal Cancers1
1CompletedTreatmentMesothelioma, Malignant1
1CompletedTreatmentOvarian Cancer / Primary Peritoneal Cavity Cancer1
1CompletedTreatmentRenal Cancers1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1Not Yet RecruitingTreatmentAnatomic Stage 0 Breast Cancer AJCC v8 / Anatomic Stage I Breast Cancer AJCC v8 / Anatomic Stage IA Breast Cancer AJCC v8 / Anatomic Stage IB Breast Cancer AJCC v8 / Anatomic Stage II Breast Cancer AJCC v8 / Anatomic Stage IIA Breast Cancer AJCC v8 / Anatomic Stage IIB Breast Cancer AJCC v8 / Early-Stage Breast Carcinoma / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Prognostic Stage 0 Breast Cancer AJCC v8 / Prognostic Stage I Breast Cancer AJCC v8 / Prognostic Stage IA Breast Cancer AJCC v8 / Prognostic Stage IB Breast Cancer AJCC v8 / Prognostic Stage II Breast Cancer AJCC v8 / Prognostic Stage IIA Breast Cancer AJCC v8 / Prognostic Stage IIB Breast Cancer AJCC v8 / Triple-Negative Breast Carcinoma1
1TerminatedTreatmentMalignancies1
1TerminatedTreatmentRenal Cancers1
1Unknown StatusTreatmentColorectal Cancers / Renal Cancers1
1, 2CompletedTreatmentColorectal Cancers / Renal Cancers1
1, 2CompletedTreatmentMelanoma (Skin)1
1, 2CompletedTreatmentRenal Cancers2
1, 2RecruitingTreatmentRecurrent Ovarian Cancer1
1, 2TerminatedTreatmentBreast Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
1, 2TerminatedTreatmentFallopian Tube Cancer / Ovarian Cancer / Peritoneal Cavity Cancer1
1, 2Unknown StatusTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
2Active Not RecruitingTreatmentHepatitis D, Chronic1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma1
2CompletedTreatmentBladder Cancers1
2CompletedTreatmentBrain and Central Nervous System Tumors1
2CompletedTreatmentBreast Cancer / Chronic Myeloproliferative Disorders / Gestational Trophoblastic Disease / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Neuroblastomas / Ovarian Cancer / Renal Cancers / Sarcomas / Testicular germ cell tumour1
2CompletedTreatmentBreast Cancer / Colorectal Cancers / Lung Cancers / Malignant Neoplasm of Pancreas / Mesothelioma, Malignant / Renal Cancers1
2CompletedTreatmentCarcinoid tumour of the gastrointestinal tract / Extrahepatic Bile Duct Cancer / Liver Cancer / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Small Intestine Cancer1
2CompletedTreatmentCarcinoid tumour of the gastrointestinal tract / Lung Cancers1
2CompletedTreatmentCervical Cancers / Esophageal Cancers / Head and Neck Carcinoma / Lung Cancers / Non-Melanomatous Skin Cancer / Penile Cancer1
2CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection6
2CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Precancerous/Nonmalignant Condition / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentDiffuse Intrinsic Pontine Glioma (DIPG)1
2CompletedTreatmentDisseminated Sclerosis1
2CompletedTreatmentGliomas1
2CompletedTreatmentHCV Coinfection / Human Immunodeficiency Virus Type 1 (HIV-1) Infection1
2CompletedTreatmentHead and Neck Carcinoma1
2CompletedTreatmentHepatitis C Viral Infection3
2CompletedTreatmentHepatitis C Viral Infection / Human Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)2
2CompletedTreatmentLeukemias10
2CompletedTreatmentLeukemias / Malignant Lymphomas / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedTreatmentLiver Cancer1
2CompletedTreatmentLocoregional Metastases in Malignant Melanoma Stages IIIB/C1
2CompletedTreatmentMalignant Lymphomas5
2CompletedTreatmentMalignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm1
2CompletedTreatmentMalignant Lymphomas / Small Intestine Cancer1
2CompletedTreatmentMalignant Neoplasm of Pancreas3
2CompletedTreatmentMalignant Neoplasm of Stomach1
2CompletedTreatmentMelanoma (Skin)6
2CompletedTreatmentMelanoma (Skin) / Renal Cancers1
2CompletedTreatmentMelanoma (Skin) / Renal Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentMetastatic Gastrointestinal Carcinoid Tumor / Recurrent Gastrointestinal Carcinoid Tumor / Regional Gastrointestinal Carcinoid Tumor1
2CompletedTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm4
2CompletedTreatmentPolycythemia Vera (PV)1
2CompletedTreatmentProstate Cancer1
2CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
2CompletedTreatmentRecurrent Melanoma / Stage IV Skin Melanoma1
2CompletedTreatmentRefractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
2CompletedTreatmentRenal Cancers6
2CompletedTreatmentRenal Cell Cancer, Recurrent / Stage IV Renal Cell Cancer1
2Not Yet RecruitingTreatmentHLA-A2 Positive Cells Present / Refractory Melanoma1
2Not Yet RecruitingTreatmentRhinovirus Infection1
2RecruitingTreatmentAdenocarcinoma, Prostate / Stage I Prostate Cancer AJCC v8 / Stage II Prostate Cancer AJCC v8 / Stage IIA Prostate Cancer AJCC v8 / Stage IIB Prostate Cancer AJCC v8 / Stage IIC Prostate Cancer AJCC v8 / Stage III Prostate Cancer AJCC v8 / Stage IIIA Prostate Cancer AJCC v8 / Stage IIIB Prostate Cancer AJCC v8 / Stage IIIC Prostate Cancer AJCC v81
2RecruitingTreatmentAdult T-cell lymphomas/leukaemias1
2RecruitingTreatmentHepatitis B Chronic Infection1
2RecruitingTreatmentHepatocellular,Carcinoma1
2RecruitingTreatmentMetastatic Carcinoma in the Liver / Recurrent Colorectal Carcinoma / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer AJCC v71
2RecruitingTreatmentPrimary Myelofibrosis / Secondary Myelofibrosis1
2TerminatedTreatmentAgnogenic Myeloid Metaplasia1
2TerminatedTreatmentClear Cell Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
2TerminatedTreatmentEsophageal Cancers1
2TerminatedTreatmentLeukemias4
2TerminatedTreatmentMalignant Neoplasm of Pancreas1
2TerminatedTreatmentMelanoma (Skin)1
2TerminatedTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2TerminatedTreatmentRecurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma1
2Unknown StatusTreatmentLeukemias1
2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
2Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2Unknown StatusTreatmentRenal Cancers3
2Unknown StatusTreatmentSarcomas1
2WithdrawnTreatmentLeukemias / Multiple Myeloma and Plasma Cell Neoplasm1
2WithdrawnTreatmentMalignant Lymphomas1
2, 3CompletedTreatmentChronic Chronic myelogenous leukemia / Malignant Melanoma / Renal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentAtypical Carcinoid Tumor / Carcinoid Tumors / Colorectal Neuroendocrine Tumor G1 / Gastric Neuroendocrine Tumor G1 / Neuroendocrine Carcinomas / Neuroendocrine Neoplasms1
3Active Not RecruitingTreatmentLocalized Osteosarcoma / Metastatic Bone Sarcomas1
3Active Not RecruitingTreatmentMelanoma (Skin)1
3Active Not RecruitingTreatmentMelanoma of Unknown Primary / Recurrent Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma1
3Active Not RecruitingTreatmentMetastatic Cutaneous Melanoma / Metastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Cutaneous Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v7 / Stages III Skin Melanoma1
3CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection5
3CompletedTreatmentGenotype 1 Chronic Hepatitis C1
3CompletedTreatmentHead and Neck Carcinoma1
3CompletedTreatmentHepatitis B Chronic Infection1
3CompletedTreatmentHepatitis C Viral Infection2
3CompletedTreatmentHepatitis C Viral Infection / Human Immunodeficiency Virus (HIV) Infections1
3CompletedTreatmentHepatitis C Virus Infection1
3CompletedTreatmentHepatitis C, Genotype 11
3CompletedTreatmentLeukemias3
3CompletedTreatmentMalignant Lymphomas1
3CompletedTreatmentMelanoma (Skin)5
3CompletedTreatmentMelanoma / Skin Cancers1
3CompletedTreatmentMetastatic Renal Cell Carcinoma1
3CompletedTreatmentMultiple Myeloma (MM)1
3CompletedTreatmentNeoplasms, Kidney / Renal Cell Adenocarcinoma1
3CompletedTreatmentRenal Cancers6
3CompletedTreatmentRenal Cell Adenocarcinoma3
3RecruitingTreatmentChronic Myeloid Leukemia (CML)1
3RecruitingTreatmentHepatitis Delta Virus1
3TerminatedTreatmentChronic Hepatitis C Virus (HCV) Infection1
3TerminatedTreatmentInfection NOS1
3TerminatedTreatmentMalignant Lymphomas1
3Unknown StatusTreatmentBladder Cancers1
3Unknown StatusTreatmentColorectal Cancers1
3Unknown StatusTreatmentHepatitis B Chronic Infection1
3Unknown StatusTreatmentLate Complication From Liver Transplant1
3Unknown StatusTreatmentLeukemias3
3Unknown StatusTreatmentMalignant Lymphomas3
3Unknown StatusTreatmentMelanoma (Skin)3
3Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
3WithdrawnTreatmentMelanoma (Skin)1
4CompletedNot AvailableChronic Hepatitis C Virus (HCV) Infection1
4CompletedPreventionChronic Hepatitis C Virus (HCV) Infection1
4CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection1
4CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection / Human Immunodeficiency Virus (HIV) Infections1
4CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection / Type 2 Diabetes Mellitus1
4CompletedTreatmentConjunctival Intraepithelial Neoplasia / Corneal Intraepithelial Neoplasia1
4CompletedTreatmentHepatitis C Viral Infection4
4RecruitingTreatmentHepatitis B Chronic Infection1
4TerminatedTreatmentHepatitis / Human Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS)1
4TerminatedTreatmentMalignant Lymphomas / Precancerous/Nonmalignant Condition1
4Unknown StatusTreatmentHepatitis C Viral Infection1
Not AvailableActive Not RecruitingTreatmentHepatitis B Chronic Infection1
Not AvailableCompletedNot AvailableHepatitis B Chronic Infection1
Not AvailableCompletedNot AvailableHepatitis C Viral Infection / Human Immunodeficiency Virus (HIV) / Infection NOS1
Not AvailableCompletedNot AvailableMelanoma (Skin)1
Not AvailableNot Yet RecruitingTreatmentEfficacy, Self / Hepatitis B Chronic Infection1
Not AvailableNot Yet RecruitingTreatmentFibrosis, Liver / Viral Hepatitis B1
Not AvailableTerminatedNot AvailableMelanoma1
Not AvailableTerminatedTreatmentMalignant Lymphomas1
Not AvailableUnknown StatusNot AvailableChronic Hepatitis C Virus (HCV) Infection1
Not AvailableWithdrawnTreatmentEnd Stage Renal Disease (ESRD) / Hepatitis C Infection1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Type i interferon receptor activity
Specific Function
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JA...
Gene Name
IFNAR1
Uniprot ID
P17181
Uniprot Name
Interferon alpha/beta receptor 1
Molecular Weight
63524.81 Da

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
Gene Name
CYP1A2
Uniprot ID
P05177
Uniprot Name
Cytochrome P450 1A2
Molecular Weight
58293.76 Da
References
  1. Delaporte E, Renton KW: Cytochrome P4501A1 and cytochrome P4501A2 are downregulated at both transcriptional and post-transcriptional levels by conditions resulting in interferon-alpha/beta induction. Life Sci. 1997;60(10):787-96. doi: 10.1016/s0024-3205(97)00006-4. [PubMed:9064483]

Drug created on November 18, 2007 11:22 / Updated on December 02, 2019 07:09