Solute carrier family 22 member 11

Details

Name
Solute carrier family 22 member 11
Synonyms
  • OAT4
  • Organic anion transporter 4
Gene Name
SLC22A11
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001752|Solute carrier family 22 member 11
MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAV
STNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYD
RSVFTSTIVAKWDLVCSSQGLKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQL
AVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSA
GQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA
RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISY
YGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM
LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGP
LILMSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQ
EAVTVESTSL
Number of residues
550
Molecular Weight
59970.945
Theoretical pI
8.71
GO Classification
Functions
inorganic anion exchanger activity / organic anion transmembrane transporter activity / sodium-independent organic anion transmembrane transporter activity
Processes
anion transmembrane transport / organic anion transport / sodium-independent organic anion transport / transmembrane transport / urate metabolic process
Components
apical plasma membrane / external side of plasma membrane / extracellular exosome / integral component of plasma membrane / plasma membrane
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Mediates saturable uptake of estrone sulfate, dehydroepiandrosterone sulfate and related compounds.
Pfam Domain Function
Transmembrane Regions
11-31 143-163 175-195 201-221 232-252 257-277 347-367 379-399 403-423 431-451 464-484 491-511
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010620|Solute carrier family 22 member 11 (SLC22A11)
ATGGCGTTCTCGAAGCTCTTGGAGCAAGCCGGAGGCGTGGGCCTCTTCCAGACCCTGCAG
GTGCTCACCTTCATCCTCCCCTGCCTCATGATACCTTCCCAGATGCTCCTGGAGAACTTC
TCAGCCGCCATCCCAGGCCACCGATGCTGGACACACATGCTGGACAATGGCTCTGCGGTT
TCCACAAACATGACCCCCAAGGCCCTTCTGACCATCTCCATCCCGCCAGGCCCCAACCAG
GGGCCCCACCAGTGCCGCCGCTTCCGCCAGCCACAGTGGCAGCTCTTGGACCCCAATGCC
ACGGCCACCAGCTGGAGCGAAGCTGACACGGAGCCGTGTGTGGACGGCTGGGTCTATGAC
CGCAGCGTCTTCACCTCCACCATCGTGGCCAAGTGGGACCTGGTGTGCAGCTCCCAGGGC
TTGAAGCCCCTAAGCCAGTCCATCTTCATGTCCGGGATCCTGGTGGGCTCCTTTATCTGG
GGCCTCCTCTCCTACCGGTTTGGGAGGAAGCCGATGCTGAGCTGGTGCTGCCTGCAGTTG
GCCGTGGCGGGCACCAGCACCATCTTCGCCCCAACATTCGTCATCTACTGCGGCCTGCGG
TTCGTGGCCGCTTTTGGGATGGCCGGCATCTTTCTGAGTTCACTGACACTGATGGTGGAG
TGGACCACGACCAGCAGGAGGGCGGTCACCATGACGGTGGTGGGATGTGCCTTCAGCGCA
GGCCAGGCGGCGCTGGGCGGCCTGGCCTTTGCCCTGCGGGACTGGAGGACTCTCCAGCTG
GCAGCATCAGTGCCCTTCTTTGCCATCTCCCTGATATCCTGGTGGCTGCCAGAATCCGCC
CGGTGGCTGATTATTAAGGGCAAACCAGACCAAGCACTTCAGGAGCTCAGAAAGGTGGCC
AGGATAAATGGCCACAAGGAGGCCAAGAACCTGACCATAGAGGTGCTGATGTCCAGCGTG
AAGGAGGAGGTGGCCTCTGCAAAGGAGCCGCGGTCGGTGCTGGACCTGTTCTGCGTGCCC
GTGCTCCGCTGGAGGAGCTGCGCCATGCTGGTGGTGAAGATGACAGCAGATGGCATTCTG
CATACAGTGGGCCGGCTGGGGGCTATGATGGGTCCCCTGATCCTGATGAGCCGCCAAGCC
CTGCCCCTGCTGCCTCCTCTCCTCTATGGCGTTATCTCCATTGCTTCCAGCCTGGTTGTG
CTGTTCTTCCTCCCGGAGACCCAGGGACTTCCGCTCCCTGACACTATCCAGGACCTGGAG
AGCCAGAAATCAACAGCAGCCCAGGGCAACCGGCAAGAGGCCGTCACTGTGGAAAGTACC
TCGCTCTAG
Chromosome Location
11
Locus
11q13.1
External Identifiers
ResourceLink
UniProtKB IDQ9NSA0
UniProtKB Entry NameS22AB_HUMAN
GenBank Protein ID7707622
GenBank Gene IDAB026116
GenAtlas IDSLC22A11
HGNC IDHGNC:18120
General References
  1. Cha SH, Sekine T, Kusuhara H, Yu E, Kim JY, Kim DK, Sugiyama Y, Kanai Y, Endou H: Molecular cloning and characterization of multispecific organic anion transporter 4 expressed in the placenta. J Biol Chem. 2000 Feb 11;275(6):4507-12. [PubMed:10660625]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Zhou F, Pan Z, Ma J, You G: Mutational analysis of histidine residues in human organic anion transporter 4 (hOAT4). Biochem J. 2004 Nov 15;384(Pt 1):87-92. [PubMed:15291761]
  6. Zhou F, Tanaka K, Pan Z, Ma J, You G: The role of glycine residues in the function of human organic anion transporter 4. Mol Pharmacol. 2004 May;65(5):1141-7. [PubMed:15102942]
  7. Zhou F, Xu W, Hong M, Pan Z, Sinko PJ, Ma J, You G: The role of N-linked glycosylation in protein folding, membrane targeting, and substrate binding of human organic anion transporter hOAT4. Mol Pharmacol. 2005 Mar;67(3):868-76. Epub 2004 Dec 2. [PubMed:15576633]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01032Probenecidapproved, investigationalyesinhibitorDetails
DB00759Tetracyclineapproved, vet_approvedunknowninhibitorDetails
DB00595Oxytetracyclineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01017Minocyclineapproved, investigationalunknowninhibitorDetails
DB00917DinoprostoneapprovedunknowninhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedunknowninhibitorDetails
DB01212CeftriaxoneapprovedunknowninhibitorDetails
DB00493CefotaximeapprovedunknowninhibitorDetails
DB01329Cefoperazoneapproved, investigationalunknowninhibitorDetails
DB01327CefazolinapprovedunknowninhibitorDetails
DB01326Cefamandoleapproved, experimentalunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB00554Piroxicamapproved, investigationalunknowninhibitorDetails
DB01053Benzylpenicillinapproved, vet_approvedunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknownsubstrateinhibitorDetails
DB04519Caprylic acidinvestigationalunknowninhibitorDetails
DB00328Indomethacinapproved, investigationalunknowninhibitorDetails
DB00168Aspartameinvestigational, nutraceuticalunknowninhibitorDetails
DB00812Phenylbutazoneapproved, vet_approvedunknowninhibitorDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB01050IbuprofenapprovedunknowninhibitorDetails
DB00936Salicylic acidapproved, investigational, vet_approvedunknowninhibitorDetails
DB03553Glutaric AcidexperimentalunknowninhibitorDetails
DB00695Furosemideapproved, vet_approvedunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB00887BumetanideapprovedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB00175PravastatinapprovednosubstrateDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB01051Novobiocinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB00495ZidovudineapprovedunknownDetails
DB01160Dinoprost tromethamineapproved, vet_approvedunknownDetails
DB04133Degraded CephaloridineexperimentalunknownDetails
DB08846Ellagic acidinvestigationalunknownDetails
DB00493CefotaximeapprovedunknownDetails
DB01212CeftriaxoneapprovedunknownDetails
DB11560Lesinuradapproved, investigationalyesinhibitorDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails
DB09213Dexibuprofenapproved, investigationalunknownDetails
DB12377Relebactamapproved, investigationalunknownsubstrateDetails
DB06282LevocetirizineapprovedunknownsubstrateDetails
DB00999Hydrochlorothiazideapproved, vet_approvedunknownsubstrateDetails