Canalicular multispecific organic anion transporter 2

Details

Name
Canalicular multispecific organic anion transporter 2
Synonyms
  • ATP-binding cassette sub-family C member 3
  • CMOAT2
  • MLP2
  • MOAT-D
  • MRP3
  • Multi-specific organic anion transporter D
  • Multidrug resistance-associated protein 3
Gene Name
ABCC3
Organism
Human
Amino acid sequence
>lcl|BSEQ0002113|Canalicular multispecific organic anion transporter 2
MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHC
RGYIILSHLSKLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLAT
LLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFAL
VLSALILACFREKPPFFSAKNVDPNPYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDL
WSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNASGEDEVLLGARPRPRKPSFL
KALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCS
MMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF
MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQ
MKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWM
CSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLK
RIQQFLSQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVV
GPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRY
QQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSA
VDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ
RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQ
KQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW
DYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGI
LQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVD
EVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLE
SVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVE
FVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV
KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVG
IVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTL
RMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARAL
LRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGV
VAEFDSPANLIAARGIFYGMARDAGLA
Number of residues
1527
Molecular Weight
169341.14
Theoretical pI
7.2
GO Classification
Functions
ATP binding / ATPase activity, coupled to transmembrane movement of substances / organic anion transmembrane transporter activity
Processes
transport / small molecule metabolic process / transmembrane transport / bile acid metabolic process / bile acid and bile salt transport
Components
membrane / plasma membrane / integral component of plasma membrane
General Function
Organic anion transmembrane transporter activity
Specific Function
May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes (By similarity).
Pfam Domain Function
Transmembrane Regions
33-53 74-94 100-120 133-153 172-192 303-323 350-370 427-447 451-471 534-554 577-597 964-984 1022-1042 1086-1106 1108-1128 1200-1220 1223-1243
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010744|Canalicular multispecific organic anion transporter 2 (ABCC3)
ATGGACGCCCTGTGCGGTTCCGGGGAGCTCGGCTCCAAGTTCTGGGACTCCAACCTGTCT
GTGCACACAGAAAACCCGGACCTCACTCCCTGCTTCCAGAACTCCCTGCTGGCCTGGGTG
CCCTGCATCTACCTGTGGGTCGCCCTGCCCTGCTACTTGCTCTACCTGCGGCACCATTGT
CGTGGCTACATCATCCTCTCCCACCTGTCCAAGCTCAAGATGGTCCTGGGTGTCCTGCTG
TGGTGCGTCTCCTGGGCGGACCTTTTTTACTCCTTCCATGGCCTGGTCCATGGCCGGGCC
CCTGCCCCTGTTTTCTTTGTCACCCCCTTGGTGGTGGGGGTCACCATGCTGCTGGCCACC
CTGCTGATACAGTATGAGCGGCTGCAGGGCGTACAGTCTTCGGGGGTCCTCATTATCTTC
TGGTTCCTGTGTGTGGTCTGCGCCATCGTCCCATTCCGCTCCAAGATCCTTTTAGCCAAG
GCAGAGGGTGAGATCTCAGACCCCTTCCGCTTCACCACCTTCTACATCCACTTTGCCCTG
GTACTCTCTGCCCTCATCTTGGCCTGCTTCAGGGAGAAACCTCCATTTTTCTCCGCAAAG
AATGTCGACCCTAACCCCTACCCTGAGACCAGCGCTGGCTTTCTCTCCCGCCTGTTTTTC
TGGTGGTTCACAAAGATGGCCATCTATGGCTACCGGCATCCCCTGGAGGAGAAGGACCTC
TGGTCCCTAAAGGAAGAGGACAGATCCCAGATGGTGGTGCAGCAGCTGCTGGAGGCATGG
AGGAAGCAGGAAAAGCAGACGGCACGACACAAGGCTTCAGCAGCACCTGGGAAAAATGCC
TCCGGCGAGGACGAGGTGCTGCTGGGTGCCCGGCCCAGGCCCCGGAAGCCCTCCTTCCTG
AAGGCCCTGCTGGCCACCTTCGGCTCCAGCTTCCTCATCAGTGCCTGCTTCAAGCTTATC
CAGGACCTGCTCTCCTTCATCAATCCACAGCTGCTCAGCATCCTGATCAGGTTTATCTCC
AACCCCATGGCCCCCTCCTGGTGGGGCTTCCTGGTGGCTGGGCTGATGTTCCTGTGCTCC
ATGATGCAGTCGCTGATCTTACAACACTATTACCACTACATCTTTGTGACTGGGGTGAAG
TTTCGTACTGGGATCATGGGTGTCATCTACAGGAAGGCTCTGGTTATCACCAACTCAGTC
AAACGTGCGTCCACTGTGGGGGAAATTGTCAACCTCATGTCAGTGGATGCCCAGCGCTTC
ATGGACCTTGCCCCCTTCCTCAATCTGCTGTGGTCAGCACCCCTGCAGATCATCCTGGCG
ATCTACTTCCTCTGGCAGAACCTAGGTCCCTCTGTCCTGGCTGGAGTCGCTTTCATGGTC
TTGCTGATTCCACTCAACGGAGCTGTGGCCGTGAAGATGCGCGCCTTCCAGGTAAAGCAA
ATGAAATTGAAGGACTCGCGCATCAAGCTGATGAGTGAGATCCTGAACGGCATCAAGGTG
CTGAAGCTGTACGCCTGGGAGCCCAGCTTCCTGAAGCAGGTGGAGGGCATCAGGCAGGGT
GAGCTCCAGCTGCTGCGCACGGCGGCCTACCTCCACACCACAACCACCTTCACCTGGATG
TGCAGCCCCTTCCTGGTGAGGCTTGGCACAGGGCTGGGTCCCTGCCTCCAGGGCTCTGGG
TGCCCAGGCATGGCCAGGGCTCATTGGACTCTACCCTGA
Chromosome Location
17
Locus
17q22
External Identifiers
ResourceLink
UniProtKB IDO15438
UniProtKB Entry NameMRP3_HUMAN
GenBank Protein ID3132270
GenBank Gene IDAB010887
GenAtlas IDABCC3
HGNC IDHGNC:54
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknowninducerDetails
DB00515CisplatinapprovedunknowninducerDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB01045RifampicinapprovedunknowninducerDetails
DB01115NifedipineapprovedunknowninducerDetails
DB01011Metyraponeapproved, investigationalunknowninducerDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninducerDetails
DB01138SulfinpyrazoneapprovedunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB00328Indomethacinapproved, investigationalunknowninhibitorDetails
DB00541Vincristineapproved, investigationalunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateinhibitorDetails
DB00773EtoposideapprovedunknownsubstrateinhibitorDetails
DB00997Doxorubicinapproved, investigationalunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00563MethotrexateapprovedunknownsubstrateinhibitorDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknowninhibitorDetails
DB02659Cholic AcidapprovedunknowninhibitorDetails
DB00143Glutathioneapproved, investigational, nutraceuticalunknownsubstrateDetails
DB00158Folic Acidapproved, nutraceutical, vet_approvedunknownsubstrateDetails
DB08884Gadoxetic acidapprovedunknownsubstrateDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB05928DovitinibinvestigationalunknownDetails