Delta-type opioid receptor

Details

Name
Delta-type opioid receptor
Synonyms
  • D-OR-1
  • OPRD
Gene Name
OPRD1
Organism
Human
Amino acid sequence
>lcl|BSEQ0010290|Delta-type opioid receptor
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Number of residues
372
Molecular Weight
40368.235
Theoretical pI
9.17
GO Classification
Functions
opioid receptor activity / enkephalin receptor activity / neuropeptide binding
Processes
negative regulation of gene expression / positive regulation of CREB transcription factor activity / G-protein coupled receptor signaling pathway / regulation of sensory perception of pain / protein import into nucleus, translocation / phospholipase C-activating G-protein coupled receptor signaling pathway / cellular response to growth factor stimulus / immune response / adult locomotory behavior / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / neuropeptide signaling pathway / adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / synaptic transmission / regulation of calcium ion transport / cellular response to toxic substance / eating behavior / cellular response to hypoxia / negative regulation of protein oligomerization / positive regulation of peptidyl-serine phosphorylation / regulation of mitochondrial membrane potential / opioid receptor signaling pathway
Components
cytoplasm / postsynaptic membrane / membrane raft / plasma membrane / neuron projection / dendrite membrane / vesicle / intrinsic component of plasma membrane / integral component of plasma membrane / axon terminus
General Function
Opioid receptor activity
Specific Function
G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.
Pfam Domain Function
Transmembrane Regions
48-75 86-110 123-144 164-186 207-238 262-284 300-321
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010291|Delta-type opioid receptor (OPRD1)
ATGGAACCGGCCCCCTCCGCCGGCGCCGAGCTGCAGCCCCCGCTCTTCGCCAACGCCTCG
GACGCCTACCCTAGCGCCTGCCCCAGCGCTGGCGCCAATGCGTCGGGGCCGCCAGGCGCG
CGGAGCGCCTCGTCCCTCGCCCTGGCAATCGCCATCACCGCGCTCTACTCGGCCGTGTGC
GCCGTGGGGCTGCTGGGCAACGTGCTTGTCATGTTCGGCATCGTCCGGTACACTAAGATG
AAGACGGCCACCAACATCTACATCTTCAACCTGGCCTTAGCCGATGCGCTGGCCACCAGC
ACGCTGCCTTTCCAGAGTGCCAAGTACCTGATGGAGACGTGGCCCTTCGGCGAGCTGCTC
TGCAAGGCTGTGCTCTCCATCGACTACTACAATATGTTCACCAGCATCTTCACGCTCACC
ATGATGAGTGTTGACCGCTACATCGCTGTCTGCCACCCTGTCAAGGCCCTGGACTTCCGC
ACGCCTGCCAAGGCCAAGCTGATCAACATCTGTATCTGGGTCCTGGCCTCAGGCGTTGGC
GTGCCCATCATGGTCATGGCTGTGACCCGTCCCCGGGACGGGGCAGTGGTGTGCATGCTC
CAGTTCCCCAGCCCCAGCTGGTACTGGGACACGGTGACCAAGATCTGCGTGTTCCTCTTC
GCCTTCGTGGTGCCCATCCTCATCATCACCGTGTGCTATGGCCTCATGCTGCTGCGCCTG
CGCAGTGTGCGCCTGCTGTCGGGCTCCAAGGAGAAGGACCGCAGCCTGCGGCGCATCACG
CGCATGGTGCTGGTGGTTGTGGGCGCCTTCGTGGTGTGTTGGGCGCCCATCCACATCTTC
GTCATCGTCTGGACGCTGGTGGACATCGACCGGCGCGACCCGCTGGTGGTGGCTGCGCTG
CACCTGTGCATCGCGCTGGGCTACGCCAATAGCAGCCTCAACCCCGTGCTCTACGCTTTC
CTCGACGAGAACTTCAAGCGCTGCTTCCGCCAGCTCTGCCGCAAGCCCTGCGGCCGCCCA
GACCCCAGCAGCTTCAGCCGCGCCCGCGAAGCCACGGCCCGCGAGCGTGTCACCGCCTGC
ACCCCGTCCGATGGTCCCGGCGGTGGCGCTGCCGCCTGA
Chromosome Location
1
Locus
1p36.1-p34.3
External Identifiers
ResourceLink
UniProtKB IDP41143
UniProtKB Entry NameOPRD_HUMAN
GenBank Protein ID27545517
GenBank Gene IDU07882
GenAtlas IDOPRD1
HGNC IDHGNC:8153
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00318Codeineapproved, illicityesagonistDetails
DB00327Hydromorphoneapproved, illicityespartial agonistDetails
DB00647Dextropropoxypheneapproved, illicit, investigational, withdrawnyesagonistDetails
DB00844NalbuphineapprovedyesantagonistDetails
DB00956Hydrocodoneapproved, illicityesagonistDetails
DB00295Morphineapproved, investigationalyesagonistDetails
DB00611Butorphanolapproved, illicit, vet_approvedyesagonistDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedyesagonistDetails
DB01183Naloxoneapproved, vet_approvedyesantagonistDetails
DB01497Etorphineillicit, vet_approvedyesagonistDetails
DB01548Diprenorphineillicit, vet_approvedyesantagonistDetails
DB014393-Methylthiofentanylexperimental, illicityesagonistDetails
DB01444Dimethylthiambuteneexperimental, illicitunknownagonistDetails
DB00836LoperamideapprovedyesagonistDetails
DB00704Naltrexoneapproved, investigational, vet_approvedyesantagonistDetails
DB015713-MethylfentanylillicityesagonistDetails
DB05050ADL5859investigationalunknownDetails
DB00497Oxycodoneapproved, illicit, investigationalyesagonistDetails
DB06204TapentadolapprovedunknownDetails
DB01452Heroinapproved, illicit, investigationalunknownagonistDetails
DB00193Tramadolapproved, investigationalnoagonistDetails
DB00333MethadoneapprovedyesagonistDetails
DB00708Sufentanilapproved, investigationalunknownagonistDetails
DB01535Carfentanilillicit, investigational, vet_approvedyesagonistDetails
DB01192Oxymorphoneapproved, investigational, vet_approvedunknownantagonistDetails
DB00321AmitriptylineapprovedunknownagonistDetails
DB01081Diphenoxylateapproved, illicitunknownagonistDetails
DB00854LevorphanolapprovedunknownagonistDetails
DB01565Dihydromorphineexperimental, illicitunknownagonistDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownantagonistDetails
DB06274AlvimopanapprovedunknownantagonistDetails
DB00899RemifentanilapprovedunknownagonistDetails
DB06738Ketobemidoneapproved, investigationalyesagonistDetails
DB00514DextromethorphanapprovedunknownagonistDetails
DB01221Ketamineapproved, vet_approvedunknownbinderDetails
DB09272EluxadolineapprovedyesantagonistDetails
DB09396Propoxyphene napsylateapprovedyesagonistDetails
DB11691NaldemedineapprovedyesantagonistDetails
DB06230Nalmefeneinvestigational, withdrawnyesantagonistDetails