Delta-type opioid receptor

Details

Name
Delta-type opioid receptor
Synonyms
  • D-OR-1
  • OPRD
Gene Name
OPRD1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010290|Delta-type opioid receptor
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Number of residues
372
Molecular Weight
40368.235
Theoretical pI
9.17
GO Classification
Functions
enkephalin receptor activity / neuropeptide binding / opioid receptor activity
Processes
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / adult locomotory behavior / cellular response to growth factor stimulus / cellular response to hypoxia / cellular response to toxic substance / eating behavior / G-protein coupled receptor signaling pathway / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / immune response / negative regulation of gene expression / negative regulation of protein oligomerization / neuropeptide signaling pathway / opioid receptor signaling pathway / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of CREB transcription factor activity / positive regulation of peptidyl-serine phosphorylation / protein import into nucleus, translocation / regulation of calcium ion transport / regulation of mitochondrial membrane potential / regulation of sensory perception of pain / synaptic transmission
Components
axon terminus / cytoplasm / dendrite membrane / integral component of plasma membrane / intrinsic component of plasma membrane / membrane raft / neuron projection / plasma membrane / postsynaptic membrane / vesicle
General Function
Opioid receptor activity
Specific Function
G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.
Pfam Domain Function
Transmembrane Regions
48-75 86-110 123-144 164-186 207-238 262-284 300-321
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010291|Delta-type opioid receptor (OPRD1)
ATGGAACCGGCCCCCTCCGCCGGCGCCGAGCTGCAGCCCCCGCTCTTCGCCAACGCCTCG
GACGCCTACCCTAGCGCCTGCCCCAGCGCTGGCGCCAATGCGTCGGGGCCGCCAGGCGCG
CGGAGCGCCTCGTCCCTCGCCCTGGCAATCGCCATCACCGCGCTCTACTCGGCCGTGTGC
GCCGTGGGGCTGCTGGGCAACGTGCTTGTCATGTTCGGCATCGTCCGGTACACTAAGATG
AAGACGGCCACCAACATCTACATCTTCAACCTGGCCTTAGCCGATGCGCTGGCCACCAGC
ACGCTGCCTTTCCAGAGTGCCAAGTACCTGATGGAGACGTGGCCCTTCGGCGAGCTGCTC
TGCAAGGCTGTGCTCTCCATCGACTACTACAATATGTTCACCAGCATCTTCACGCTCACC
ATGATGAGTGTTGACCGCTACATCGCTGTCTGCCACCCTGTCAAGGCCCTGGACTTCCGC
ACGCCTGCCAAGGCCAAGCTGATCAACATCTGTATCTGGGTCCTGGCCTCAGGCGTTGGC
GTGCCCATCATGGTCATGGCTGTGACCCGTCCCCGGGACGGGGCAGTGGTGTGCATGCTC
CAGTTCCCCAGCCCCAGCTGGTACTGGGACACGGTGACCAAGATCTGCGTGTTCCTCTTC
GCCTTCGTGGTGCCCATCCTCATCATCACCGTGTGCTATGGCCTCATGCTGCTGCGCCTG
CGCAGTGTGCGCCTGCTGTCGGGCTCCAAGGAGAAGGACCGCAGCCTGCGGCGCATCACG
CGCATGGTGCTGGTGGTTGTGGGCGCCTTCGTGGTGTGTTGGGCGCCCATCCACATCTTC
GTCATCGTCTGGACGCTGGTGGACATCGACCGGCGCGACCCGCTGGTGGTGGCTGCGCTG
CACCTGTGCATCGCGCTGGGCTACGCCAATAGCAGCCTCAACCCCGTGCTCTACGCTTTC
CTCGACGAGAACTTCAAGCGCTGCTTCCGCCAGCTCTGCCGCAAGCCCTGCGGCCGCCCA
GACCCCAGCAGCTTCAGCCGCGCCCGCGAAGCCACGGCCCGCGAGCGTGTCACCGCCTGC
ACCCCGTCCGATGGTCCCGGCGGTGGCGCTGCCGCCTGA
Chromosome Location
1
Locus
1p36.1-p34.3
External Identifiers
ResourceLink
UniProtKB IDP41143
UniProtKB Entry NameOPRD_HUMAN
GenBank Protein ID27545517
GenBank Gene IDU07882
GenAtlas IDOPRD1
HGNC IDHGNC:8153
General References
  1. Knapp RJ, Malatynska E, Fang L, Li X, Babin E, Nguyen M, Santoro G, Varga EV, Hruby VJ, Roeske WR, et al.: Identification of a human delta opioid receptor: cloning and expression. Life Sci. 1994;54(25):PL463-9. [PubMed:8201839]
  2. Simonin F, Befort K, Gaveriaux-Ruff C, Matthes H, Nappey V, Lannes B, Micheletti G, Kieffer B: The human delta-opioid receptor: genomic organization, cDNA cloning, functional expression, and distribution in human brain. Mol Pharmacol. 1994 Dec;46(6):1015-21. [PubMed:7808419]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Whistler JL, Enquist J, Marley A, Fong J, Gladher F, Tsuruda P, Murray SR, Von Zastrow M: Modulation of postendocytic sorting of G protein-coupled receptors. Science. 2002 Jul 26;297(5581):615-20. [PubMed:12142540]
  5. Simonin F, Karcher P, Boeuf JJ, Matifas A, Kieffer BL: Identification of a novel family of G protein-coupled receptor associated sorting proteins. J Neurochem. 2004 May;89(3):766-75. [PubMed:15086532]
  6. Leskela TT, Lackman JJ, Vierimaa MM, Kobayashi H, Bouvier M, Petaja-Repo UE: Cys-27 variant of human delta-opioid receptor modulates maturation and cell surface delivery of Phe-27 variant via heteromerization. J Biol Chem. 2012 Feb 10;287(7):5008-20. doi: 10.1074/jbc.M111.305656. Epub 2011 Dec 19. [PubMed:22184124]
  7. Agirregoitia E, Peralta L, Mendoza R, Exposito A, Ereno ED, Matorras R, Agirregoitia N: Expression and localization of opioid receptors during the maturation of human oocytes. Reprod Biomed Online. 2012 May;24(5):550-7. doi: 10.1016/j.rbmo.2012.02.007. Epub 2012 Feb 22. [PubMed:22417668]
  8. Gelernter J, Kranzler HR: Variant detection at the delta opioid receptor (OPRD1) locus and population genetics of a novel variant affecting protein sequence. Hum Genet. 2000 Jul;107(1):86-8. [PubMed:10982041]
  9. Decaillot FM, Befort K, Filliol D, Yue S, Walker P, Kieffer BL: Opioid receptor random mutagenesis reveals a mechanism for G protein-coupled receptor activation. Nat Struct Biol. 2003 Aug;10(8):629-36. [PubMed:12847517]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00318Codeineapproved, illicityesagonistDetails
DB00327Hydromorphoneapproved, illicityespartial agonistDetails
DB00647Dextropropoxypheneapproved, illicit, investigational, withdrawnyesagonistDetails
DB00844NalbuphineapprovedyesantagonistDetails
DB00956Hydrocodoneapproved, illicit, investigationalyesagonistDetails
DB00295Morphineapproved, investigationalyesagonistDetails
DB00611Butorphanolapproved, illicit, vet_approvedyesagonistDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedyesagonistDetails
DB01183Naloxoneapproved, vet_approvedyesantagonistDetails
DB01497Etorphineillicit, vet_approvedyesagonistDetails
DB01548Diprenorphineillicit, vet_approvedyesantagonistDetails
DB014393-Methylthiofentanylexperimental, illicityesagonistDetails
DB01444Dimethylthiambuteneexperimental, illicitunknownagonistDetails
DB00836LoperamideapprovedyesagonistDetails
DB00704Naltrexoneapproved, investigational, vet_approvedyesantagonistDetails
DB015713-MethylfentanylillicityesagonistDetails
DB05050ADL5859investigationalunknownDetails
DB00497Oxycodoneapproved, illicit, investigationalyesagonistDetails
DB06204TapentadolapprovedunknownDetails
DB06409Morphine glucuronideinvestigationalunknownDetails
DB01452Diamorphineapproved, illicit, investigationalunknownagonistDetails
DB00193Tramadolapproved, investigationalnoagonistDetails
DB00333Methadoneapproved, illicityesagonistDetails
DB00708Sufentanilapproved, investigationalunknownagonistDetails
DB01535Carfentanilillicit, investigational, vet_approvedyesagonistDetails
DB01192Oxymorphoneapproved, investigational, vet_approvedunknownantagonistDetails
DB00321AmitriptylineapprovedunknownagonistDetails
DB01081Diphenoxylateapproved, illicitunknownagonistDetails
DB00854LevorphanolapprovedunknownagonistDetails
DB01565Dihydromorphineexperimental, illicitunknownagonistDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownantagonistDetails
DB06274Alvimopanapproved, investigationalunknownantagonistDetails
DB00899RemifentanilapprovedunknownagonistDetails
DB06738KetobemidoneinvestigationalyesagonistDetails
DB00514DextromethorphanapprovedunknownagonistDetails
DB01221Ketamineapproved, vet_approvedunknownbinderDetails
DB09272Eluxadolineapproved, investigationalyesantagonistDetails
DB11691Naldemedineapproved, investigationalyesantagonistDetails
DB06230Nalmefeneapproved, investigational, withdrawnyesantagonistDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB09209Pholcodineapproved, illicitunknownantagonistDetails
DB11130Opiumapproved, illicityesagonistDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB14146LoxicodegolinvestigationalunknownagonistDetails