Voltage-dependent L-type calcium channel subunit beta-1

Details

Name
Voltage-dependent L-type calcium channel subunit beta-1
Synonyms
  • CAB1
  • CACNLB1
  • Calcium channel voltage-dependent subunit beta 1
Gene Name
CACNB1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000603|Voltage-dependent L-type calcium channel subunit beta-1
MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LGSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGT
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Number of residues
598
Molecular Weight
65712.995
Theoretical pI
6.75
GO Classification
Functions
high voltage-gated calcium channel activity / voltage-gated calcium channel activity
Processes
axon guidance / neuromuscular junction development / protein targeting to membrane / regulation of voltage-gated calcium channel activity / synaptic transmission / transport
Components
sarcoplasmic reticulum / T-tubule / voltage-gated calcium channel complex
General Function
Voltage-gated calcium channel activity
Specific Function
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010071|Voltage-dependent L-type calcium channel subunit beta-1 (CACNB1)
ATGGTCCAGAAGACCAGCATGTCCCGGGGCCCTTACCCACCCTCCCAGGAGATCCCCATG
GAGGTCTTCGACCCCAGCCCGCAGGGCAAATACAGCAAGAGGAAAGGGCGATTCAAACGG
TCAGATGGGAGCACGTCCTCGGATACCACATCCAACAGCTTTGTCCGCCAGGGCTCAGCG
GAGTCCTACACCAGCCGTCCATCAGACTCTGATGTATCTCTGGAGGAGGACCGGGAAGCC
TTAAGGAAGGAAGCAGAGCGCCAGGCATTAGCGCAGCTCGAGAAGGCCAAGACCAAGCCA
GTGGCATTTGCTGTGCGGACAAATGTTGGCTACAATCCGTCTCCAGGGGATGAGGTGCCT
GTGCAGGGAGTGGCCATCACCTTCGAGCCCAAAGACTTCCTGCACATCAAGGAGAAATAC
AATAATGACTGGTGGATCGGGCGGCTGGTGAAGGAGGGCTGTGAGGTTGGCTTCATTCCC
AGCCCCGTCAAACTGGACAGCCTTCGCCTGCTGCAGGAACAGAAGCTGCGCCAGAACCGC
CTCGGCTCCAGCAAATCAGGCGATAACTCCAGTTCCAGTCTGGGAGATGTGGTGACTGGC
ACCCGCCGCCCCACACCCCCTGCCAGTGCCAAACAGAAGCAGAAGTCGACAGAGCATGTG
CCCCCCTATGACGTGGTGCCTTCCATGAGGCCCATCATCCTGGTGGGACCGTCGCTCAAG
GGCTACGAGGTTACAGACATGATGCAGAAAGCTTTATTTGACTTCTTGAAGCATCGGTTT
GATGGCAGGATCTCCATCACTCGTGTGACGGCAGATATTTCCCTGGCTAAGCGCTCAGTT
CTCAACAACCCCAGCAAACACATCATCATTGAGCGCTCCAACACACGCTCCAGCCTGGCT
GAGGTGCAGAGTGAAATCGAGCGAATCTTCGAGCTGGCCCGGACCCTTCAGTTGGTCGCT
CTGGATGCTGACACCATCAATCACCCAGCCCAGCTGTCCAAGACCTCGCTGGCCCCCATC
ATTGTTTACATCAAGATCACCTCTCCCAAGGTACTTCAAAGGCTCATCAAGTCCCGAGGA
AAGTCTCAGTCCAAACACCTCAATGTCCAAATAGCGGCCTCGGAAAAGCTGGCACAGTGC
CCCCCTGAAATGTTTGACATCATCCTGGATGAGAACCAATTGGAGGATGCCTGCGAGCAT
CTGGCGGAGTACTTGGAAGCCTATTGGAAGGCCACACACCCGCCCAGCAGCACGCCACCC
AATCCGCTGCTGAACCGCACCATGGCTACCGCAGCCCTGGCTGCCAGCCCTGCCCCTGTC
TCCAACCTCCAGGGACCCTACCTTGCTTCCGGGGACCAGCCACTGGAACGGGCCACCGGG
GAGCACGCCAGCATGCACGAGTACCCAGGGGAGCTGGGCCAGCCCCCAGGCCTTTACCCC
AGCAGCCACCCACCAGGCCGGGCAGGCACGCTACGGGCACTGTCCCGCCAAGACACTTTT
GATGCCGACACCCCCGGCAGCCGAAACTCTGCCTACACGGAGCTGGGAGACTCATGTGTG
GACATGGAGACTGACCCCTCAGAGGGGCCAGGGCTTGGAGACCCTGCAGGGGGCGGCACG
CCCCCAGCCCGACAGGGATCCTGGGAGGACGAGGAAGAAGACTATGAGGAAGAGCTGACC
GACAACCGGAACCGGGGCCGGAATAAGGCCCGCTACTGCGCTGAGGGTGGGGGTCCAGTT
TTGGGGCGCAACAAGAATGAGCTGGAGGGCTGGGGACGAGGCGTCTACATTCGCTGA
Chromosome Location
17
Locus
17q21-q22
External Identifiers
ResourceLink
UniProtKB IDQ02641
UniProtKB Entry NameCACB1_HUMAN
GenBank Protein ID179806
GenBank Gene IDM92303
GenAtlas IDCACNB1
HGNC IDHGNC:1401
General References
  1. Powers PA, Liu S, Hogan K, Gregg RG: Skeletal muscle and brain isoforms of a beta-subunit of human voltage-dependent calcium channels are encoded by a single gene. J Biol Chem. 1992 Nov 15;267(32):22967-72. [PubMed:1385409]
  2. Williams ME, Feldman DH, McCue AF, Brenner R, Velicelebi G, Ellis SB, Harpold MM: Structure and functional expression of alpha 1, alpha 2, and beta subunits of a novel human neuronal calcium channel subtype. Neuron. 1992 Jan;8(1):71-84. [PubMed:1309651]
  3. Collin T, Wang JJ, Nargeot J, Schwartz A: Molecular cloning of three isoforms of the L-type voltage-dependent calcium channel beta subunit from normal human heart. Circ Res. 1993 Jun;72(6):1337-44. [PubMed:7916667]
  4. Fukuda K, Kaneko S, Yada N, Kikuwaka M, Akaike A, Satoh M: Cyclic AMP-dependent modulation of N- and Q-type Ca2+ channels expressed in Xenopus oocytes. Neurosci Lett. 1996 Oct 11;217(1):13-6. [PubMed:8905728]
  5. Hogan K, Greg RG, Powers PA: Structure and alternative splicing of the gene encoding the human beta1 subunit of voltage dependent calcium channels. Neurosci Lett. 1999 Dec 24;277(2):111-4. [PubMed:10624822]
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  8. Iles DE, Segers B, Sengers RC, Monsieurs K, Heytens L, Halsall PJ, Hopkins PM, Ellis FR, Hall-Curran JL, Stewart AD, et al.: Genetic mapping of the beta 1- and gamma-subunits of the human skeletal muscle L-type voltage-dependent calcium channel on chromosome 17q and exclusion as candidate genes for malignant hyperthermia susceptibility. Hum Mol Genet. 1993 Jul;2(7):863-8. [PubMed:8395940]
  9. Brust PF, Simerson S, McCue AF, Deal CR, Schoonmaker S, Williams ME, Velicelebi G, Johnson EC, Harpold MM, Ellis SB: Human neuronal voltage-dependent calcium channels: studies on subunit structure and role in channel assembly. Neuropharmacology. 1993 Nov;32(11):1089-102. [PubMed:8107964]
  10. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00308IbutilideapprovedyesactivatorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB00653Magnesium sulfateapproved, investigational, vet_approvedunknownDetails
DB00661VerapamilapprovedyesinhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB00393Nimodipineapproved, investigationalyesinhibitorDetails
DB00898EthanolapprovedunknownDetails
DB09230AzelnidipineinvestigationalunknownagonistDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB00381AmlodipineapprovedyesblockerDetails
DB00153Ergocalciferolapproved, nutraceuticalnoinducerDetails
DB11093Calcium Citrateapproved, investigationalunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedyesinhibitorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09236Lacidipineapproved, investigationalyesantagonistDetails
DB09231BenidipineexperimentalyesantagonistDetails
DB09232CilnidipineinvestigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB00825LevomentholapprovedyesantagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails
DB00243Ranolazineapproved, investigationalnoinhibitorDetails