Voltage-dependent L-type calcium channel subunit beta-2

Details

Name
Voltage-dependent L-type calcium channel subunit beta-2
Synonyms
  • CAB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • Lambert-Eaton myasthenic syndrome antigen B
  • MYSB
Gene Name
CACNB2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004623|Voltage-dependent L-type calcium channel subunit beta-2
MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIER
IFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTL
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHN
HRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
RHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
Number of residues
660
Molecular Weight
73579.925
Theoretical pI
8.26
GO Classification
Functions
calcium channel activity / calcium channel regulator activity / voltage-gated calcium channel activity
Processes
axon guidance / calcium ion import / neuromuscular junction development / positive regulation of calcium ion transport / regulation of voltage-gated calcium channel activity / synaptic transmission / transport / visual perception
Components
integral component of plasma membrane / L-type voltage-gated calcium channel complex / voltage-gated calcium channel complex
General Function
Voltage-gated calcium channel activity
Specific Function
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021669|Voltage-dependent L-type calcium channel subunit beta-2 (CACNB2)
ATGCAGTGCTGCGGGCTGGTGCATCGCCGGCGAGTACGGGTGTCCTATGGTTCGGCAGAC
TCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTG
CGCAGAGAAGCGGAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTT
GCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTG
CCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAAC
AATGACTGGTGGATAGGGCGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGC
CCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTC
TACTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCC
AGAAAATCAACACCTCCATCATCTGCTATAGACATAGATGCTACTGGCTTAGATGCAGAA
GAAAATGATATTCCAGCAAACCACCGCTCCCCTAAACCCAGTGCAAACAGTGTAACGTCA
CCCCACTCCAAAGAGAAAAGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTAT
GATGTGGTACCTTCCATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAG
GTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGG
ATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAAT
CCCAGTAAGCACGCAATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAG
AGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCG
GATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATAT
GTAAAGATTTCTTCTCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAA
GCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAG
CTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGAC
TATCTGGAGGCCTACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTC
CTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCA
CAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAA
GCTGAAGAAGAACCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCA
GCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTT
GACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCC
CATGACCACGTGGACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCAC
GGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAG
CAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGT
GAAAAGGATGGAGAAGTGATATCAAAAAAACGGAATGAGGCTGGGGAGTGGAACAGGGAT
GTTTACATCCGCCAATGA
Chromosome Location
10
Locus
10p12
External Identifiers
ResourceLink
UniProtKB IDQ08289
UniProtKB Entry NameCACB2_HUMAN
GenBank Protein ID300417
GenBank Gene IDS60415
GenAtlas IDCACNB2
HGNC IDHGNC:1402
General References
  1. Rosenfeld MR, Wong E, Dalmau J, Manley G, Posner JB, Sher E, Furneaux HM: Cloning and characterization of a Lambert-Eaton myasthenic syndrome antigen. Ann Neurol. 1993 Jan;33(1):113-20. [PubMed:8494331]
  2. Taviaux S, Williams ME, Harpold MM, Nargeot J, Lory P: Assignment of human genes for beta 2 and beta 4 subunits of voltage-dependent Ca2+ channels to chromosomes 10p12 and 2q22-q23. Hum Genet. 1997 Aug;100(2):151-4. [PubMed:9254841]
  3. Colecraft HM, Alseikhan B, Takahashi SX, Chaudhuri D, Mittman S, Yegnasubramanian V, Alvania RS, Johns DC, Marban E, Yue DT: Novel functional properties of Ca(2+) channel beta subunits revealed by their expression in adult rat heart cells. J Physiol. 2002 Jun 1;541(Pt 2):435-52. [PubMed:12042350]
  4. Foell JD, Balijepalli RC, Delisle BP, Yunker AM, Robia SL, Walker JW, McEnery MW, January CT, Kamp TJ: Molecular heterogeneity of calcium channel beta-subunits in canine and human heart: evidence for differential subcellular localization. Physiol Genomics. 2004 Apr 13;17(2):183-200. [PubMed:14762176]
  5. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Yada H, Murata M, Shimoda K, Yuasa S, Kawaguchi H, Ieda M, Adachi T, Murata M, Ogawa S, Fukuda K: Dominant negative suppression of Rad leads to QT prolongation and causes ventricular arrhythmias via modulation of L-type Ca2+ channels in the heart. Circ Res. 2007 Jul 6;101(1):69-77. Epub 2007 May 24. [PubMed:17525370]
  8. Rahimi N, Rezazadeh K, Mahoney JE, Hartsough E, Meyer RD: Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis. Mol Biol Cell. 2012 May;23(9):1646-56. doi: 10.1091/mbc.E11-11-0934. Epub 2012 Mar 14. [PubMed:22419821]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]
  10. Antzelevitch C, Pollevick GD, Cordeiro JM, Casis O, Sanguinetti MC, Aizawa Y, Guerchicoff A, Pfeiffer R, Oliva A, Wollnik B, Gelber P, Bonaros EP Jr, Burashnikov E, Wu Y, Sargent JD, Schickel S, Oberheiden R, Bhatia A, Hsu LF, Haissaguerre M, Schimpf R, Borggrefe M, Wolpert C: Loss-of-function mutations in the cardiac calcium channel underlie a new clinical entity characterized by ST-segment elevation, short QT intervals, and sudden cardiac death. Circulation. 2007 Jan 30;115(4):442-9. Epub 2007 Jan 15. [PubMed:17224476]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00653Magnesium sulfateapproved, investigational, vet_approvedunknownDetails
DB00661VerapamilapprovedyesinhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB00381AmlodipineapprovedyesinhibitorDetails
DB01023Felodipineapproved, investigationalyesinhibitorDetails
DB00270Isradipineapproved, investigationalyesinhibitorDetails
DB01115NifedipineapprovedyesinhibitorDetails
DB00393Nimodipineapproved, investigationalyesinhibitorDetails
DB00401NisoldipineapprovedyesinhibitorDetails
DB01054Nitrendipineapproved, investigationalyesinhibitorDetails
DB00622Nicardipineapproved, investigationalyesinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB06712NilvadipineinvestigationalyesinhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium Citrateapproved, investigationalunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedyesinhibitorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09236Lacidipineapproved, investigationalyesantagonistDetails
DB09231BenidipineexperimentalyesantagonistDetails
DB09232CilnidipineinvestigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB00825LevomentholapprovedyesantagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails