Interferon alpha 2b (human leukocyte clone hif-sn 206 protein moiety reduced). A type I interferon consisting of 165 amino acid residues with arginine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent.

Protein structure

Protein chemical formula

C₈₆₀H₁₃₅₃N₂₂₉O₂₅₅S₉

Protein average weight

19271.0 Da

Sequences

>DB00105 sequence
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Download FASTA Format

Synonyms

Interferon alfa-2b
Interferon α-2b
Intron (Interferon α2b)
Intron A (Interferon α2b)
rIFN-alpha-2b

External IDs

99210-65-8 / Sch 30500 / YM 14090

Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Intron A	Liquid	25000000 unit	Subcutaneous	Merck Ltd.	1999-09-23	Not applicable
Intron A	Injection, solution	19.2 ug/0.5mL	Intralesional; Intramuscular; Subcutaneous	Merck Sharp & Dohme Limited	1986-06-04	Not applicable
Intron A	Kit	69 ug/1mL		Merck Sharp & Dohme Limited	2014-08-11	Not applicable
Intron A	Solution	6000000 unit	Intramuscular; Intravenous; Subcutaneous	Merck Ltd.	1998-12-10	Not applicable
Intron A	Kit	192 ug/1mL		Merck Sharp & Dohme Limited	1986-06-04	2016-07-31
Intron A	Liquid	15000000 unit	Subcutaneous	Merck Ltd.	1999-09-23	Not applicable
Intron A	Injection, solution	11.6 ug/0.5mL	Intramuscular; Subcutaneous	Merck Sharp & Dohme Limited	1986-06-04	Not applicable
Intron A	Kit	69 ug/1mL		Merck Sharp & Dohme Limited	1986-06-04	2016-07-31
Intron A	Liquid	50000000 unit	Subcutaneous	Merck Ltd.	1999-09-23	Not applicable
Intron A	Kit	192 ug/1mL		Merck Sharp & Dohme Limited	2014-08-11	Not applicable

Mixture Products

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
Intron A	Interferon Alfa-2b, Recombinant (10000000 unit) + Water (1 ml)	Liquid; Powder, for solution	Intralesional; Intramuscular; Intravenous; Subcutaneous	Merck Ltd.	1997-03-12	Not applicable
Intron A	Interferon Alfa-2b, Recombinant (18 miu) + Water (1 ml)	Kit; Liquid; Powder, for solution	Intralesional; Intramuscular; Intravenous; Subcutaneous	Merck Ltd.	1998-03-11	Not applicable
Intron A - Kit (pws+diluent) 3000000iu/vial	Interferon Alfa-2b, Recombinant (3000000 unit) + Water (1 ml)	Liquid; Powder, for solution	Intralesional; Intramuscular; Subcutaneous	Schering Plough (Brinny) Co.	1997-04-08	2000-07-11
Intron A - Kit (pws+diluent) 5000000iu/vial	Interferon Alfa-2b, Recombinant (5000000 unit) + Water (1 ml)	Liquid; Powder, for solution	Intralesional; Intramuscular; Subcutaneous	Schering Plough (Brinny) Co.	1998-12-31	2000-07-11
Rebetron Ready To Use Solution (albumin(human)free) (6000000 Iu/ml and 200mg Capsules)	Interferon Alfa-2b, Recombinant (6000000 unit) + Ribavirin (200 mg)	Capsule; Kit; Liquid	Oral; Subcutaneous	Schering Plough	1999-03-31	2004-10-27
Rebetron Solution (albumin (human) Free) (18 Miu Multi-dose Pen / 200mg Capsules)	Interferon Alfa-2b, Recombinant (15000000 unit) + Ribavirin (200 mg)	Capsule; Kit; Liquid	Oral; Subcutaneous	Schering Plough	1999-12-23	2004-10-27

Unapproved/Other Products

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
Intron A	Interferon Alfa-2b, Recombinant (11.6 ug/0.2mL)	Injection, solution	Subcutaneous	Schering-Plough Corporation	2008-05-22	2008-05-22
Intron A	Interferon Alfa-2b, Recombinant (38.4 ug/0.2mL)	Injection, solution	Subcutaneous	Schering-Plough Corporation	2008-05-22	2008-05-22
Intron A	Interferon Alfa-2b, Recombinant (19.2 ug/0.2mL)	Injection, solution	Subcutaneous	Schering-Plough Corporation	2008-05-22	2008-05-22

International/Other Brands

Intron A / Locteron

Categories

UNII

43K1W2T1M6

CAS number

98530-12-2

Pharmacology

Indication

For the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma.

Associated Conditions

Pharmacodynamics

Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.

Mechanism of action

Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which upon dimerization activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.

Target	Actions	Organism
AInterferon alpha/beta receptor 2	binder	Human
AInterferon alpha/beta receptor 1	binder	Human

Absorption

Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism

Not Available

Route of elimination

Not Available

Half life

The elimination half-life following both intramuscular and subcutaneous injections was approximately 2 to 3 hours. The elimination half-life was approximately 2 hours following intravenous injection.

Clearance

Not Available

Toxicity

There is limited experience with overdosage. Postmarketing surveillance includes reports of patients receiving a single dose as great as 10 times the recommended dose. In general, the primary effects of an overdose are consistent with the effects seen with therapeutic doses of interferon alfa-2b. Hepatic enzyme abnormalities, renal failure, hemorrhage, and myocardial infarction have been reported with single administration overdoses and/or with longer durations of treatment than prescribed. Toxic effects after ingestion of interferon alfa-2b are not expected because interferons are poorly absorbed orally.

Affected organisms

Humans and other mammals

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction
3-isobutyl-1-methyl-7H-xanthine	The metabolism of 3-isobutyl-1-methyl-7H-xanthine can be decreased when combined with Interferon Alfa-2b, Recombinant.
6-O-benzylguanine	The metabolism of 6-O-benzylguanine can be decreased when combined with Interferon Alfa-2b, Recombinant.
7-Deazaguanine	The metabolism of 7-Deazaguanine can be decreased when combined with Interferon Alfa-2b, Recombinant.
7,9-Dimethylguanine	The metabolism of 7,9-Dimethylguanine can be decreased when combined with Interferon Alfa-2b, Recombinant.
8-azaguanine	The metabolism of 8-azaguanine can be decreased when combined with Interferon Alfa-2b, Recombinant.
8-chlorotheophylline	The metabolism of 8-chlorotheophylline can be decreased when combined with Interferon Alfa-2b, Recombinant.
9-Deazaguanine	The metabolism of 9-Deazaguanine can be decreased when combined with Interferon Alfa-2b, Recombinant.
9-Methylguanine	The metabolism of 9-Methylguanine can be decreased when combined with Interferon Alfa-2b, Recombinant.
Acefylline	The metabolism of Acefylline can be decreased when combined with Interferon Alfa-2b, Recombinant.
Aldesleukin	The risk or severity of adverse effects can be increased when Interferon Alfa-2b, Recombinant is combined with Aldesleukin.

Food Interactions

Avoid alcohol.

References

General References

Radhakrishnan R, Walter LJ, Hruza A, Reichert P, Trotta PP, Nagabhushan TL, Walter MR: Zinc mediated dimer of human interferon-alpha 2b revealed by X-ray crystallography. Structure. 1996 Dec 15;4(12):1453-63. [PubMed:8994971]

External Links

UniProt: P01563
PubChem Substance: 46507075
Therapeutic Targets Database: DAP001285
PharmGKB: PA164783990
RxList: RxList Drug Page

ATC Codes

L03AB05 — Interferon alfa-2b

AHFS Codes

10:00.00 — Antineoplastic Agents
08:18.20 — Interferons

FDA label

Download (3.52 MB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Recruiting	Treatment	Metastatic Carcinoma in the Liver / Recurrent Colorectal Carcinoma / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer AJCC v7	1
1	Active Not Recruiting	Treatment	Melanoma	1
1	Active Not Recruiting	Treatment	Solid Cancers	1
1	Completed	Not Available	Hepatitis C Viral Infection	1
1	Completed	Treatment	Adult Solid Neoplasm	1
1	Completed	Treatment	Bladder Cancers / Urethral Cancer	1
1	Completed	Treatment	Cancer, Advanced / Tumors, Solid	1
1	Completed	Treatment	Hepatitis C Viral Infection / Human Immunodeficiency Virus (HIV) Infections	1
1	Completed	Treatment	Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)	1
1	Completed	Treatment	Melanoma	3
1	Completed	Treatment	Recurrent Melanoma / Renal Cell Cancer, Recurrent / Stage III Melanoma / Stage IV Melanoma / Stage IV Renal Cell Cancer	1
1	Recruiting	Basic Science	Soft Tissue Sarcoma Adult	1
1, 2	Active Not Recruiting	Treatment	Malignant Neoplasm of Pancreas Metastatic to Peritoneal Surface / Malignant Peritoneal Mesothelioma / Peritoneal Carcinomatosis	1
1, 2	Active Not Recruiting	Treatment	Melanoma	1
1, 2	Completed	Treatment	Chronic Hepatitis C Virus (HCV) Infection / Genotype 1 / Relapses / Treatment-Experienced Patients	1
1, 2	Completed	Treatment	Melanoma	1
1, 2	Completed	Treatment	Recurrent Ovarian Cancer	1
1, 2	Enrolling by Invitation	Treatment	Breastcancer / Neoplasms, Breast	1
1, 2	Recruiting	Treatment	Breast Neoplasm Female / Malignant Neoplasm of Female Breast	1
1, 2	Terminated	Treatment	Carcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal	1
1, 2	Terminated	Treatment	Renal Cell Adenocarcinoma	1
1, 2	Withdrawn	Treatment	Melanoma	1
2	Active Not Recruiting	Treatment	Ciliary Body and Choroid Melanoma, Medium/Large Size / Ciliary Body and Choroid Melanoma, Small Size / Iris Melanoma / Recurrent Intraocular Melanoma	1
2	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma	1
2	Completed	Treatment	Chronic Hepatitis C Virus (HCV) Infection	1
2	Completed	Treatment	Clear Cell Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer	1
2	Completed	Treatment	Clear Cell Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Renal Cell Cancer	1
2	Completed	Treatment	Cutaneous Melanoma / Metastatic Melanoma	1
2	Completed	Treatment	Hepatitis C Viral Infection	1
2	Completed	Treatment	Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)	1
2	Completed	Treatment	Leukemias	1
2	Completed	Treatment	Leukemias / Malignant Lymphomas / Unspecified Childhood Solid Tumor, Protocol Specific	1
2	Completed	Treatment	Malignant Neoplasm of Pancreas	1
2	Completed	Treatment	Recurrent Melanoma / Stage IV Melanoma	1
2	Completed	Treatment	Refractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma	1
2	Completed	Treatment	Renal Cell Adenocarcinoma / Stage IV Renal Cell Cancer	1
2	Completed	Treatment	Renal Cell Cancer, Recurrent / Stage IV Renal Cell Cancer	1
2	Recruiting	Treatment	Mucosal Melanoma	1
2	Terminated	Treatment	Clear Cell Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer	1
2	Terminated	Treatment	Leukemias	1
2	Terminated	Treatment	Mycosis Fungoides (MF) / Neoplasms, Hematologic / T-Cell Lymphomas	1
2	Terminated	Treatment	Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma	1
2	Terminated	Treatment	Renal Cell Adenocarcinoma	1
2	Unknown Status	Treatment	Metastatic Renal Cell Carcinoma	1
2	Withdrawn	Treatment	Cancer, Advanced / Tumors, Solid	1
2	Withdrawn	Treatment	Malignant Melanoma / Melanoma	1
2, 3	Completed	Treatment	Chronic Hepatitis C Virus (HCV) Infection	1
2, 3	Completed	Treatment	Hepatitis C Viral Infection	1
2, 3	Terminated	Treatment	Melanoma	1
2, 3	Terminated	Treatment	Chronic Chronic myelogenous leukemia	1
3	Active Not Recruiting	Treatment	Atypical Carcinoid Tumor / Carcinoid Tumors / Colorectal Neuroendocrine Tumor G1 / Gastric Neuroendocrine Tumor G1 / Neuroendocrine Carcinomas / Neuroendocrine Neoplasms	1
3	Active Not Recruiting	Treatment	Metastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v7 / Stages III Skin Melanoma	1
3	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma	1
3	Completed	Treatment	Chronic Myeloid Leukemia (CML)	1
3	Completed	Treatment	Malignant Melanoma / Recurrent Melanoma	1
3	Completed	Treatment	Melanoma / Neoplasms Metastasis	1
3	Completed	Treatment	Melanoma / Skin Cancers	1
3	Completed	Treatment	Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma	1
3	Recruiting	Treatment	Anaplastic Astrocytoma (AA) / Anaplastic Oligoastrocytoma / Glioblastomas	1
3	Terminated	Treatment	Human Immunodeficiency Virus (HIV) Infections	1
3	Terminated	Treatment	Melanoma (Skin)	1
3	Withdrawn	Treatment	Gastro-intestinal Neuroendocrine Tumors	1
3	Withdrawn	Treatment	Hypertrophic Scars / Minor burns	1
4	Completed	Treatment	Conjunctival Intraepithelial Neoplasia / Corneal Intraepithelial Neoplasia	1
4	Completed	Treatment	Hepatitis B Chronic Infection	1
4	Recruiting	Treatment	Lymphoma, T-Cell, Cutaneous / Mycosis Fungoides (MF)	1
4	Terminated	Treatment	Malignant Lymphomas / Precancerous/Nonmalignant Condition	1
Not Available	Active Not Recruiting	Treatment	Stage IA Skin Melanoma / Stage IB Skin Melanoma / Stage IIA Skin Melanoma / Stage IIB Skin Melanoma / Stage IIC Skin Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma	1
Not Available	Completed	Not Available	Melanoma	2
Not Available	Completed	Treatment	Human Immunodeficiency Virus (HIV) Infections / Progressive Multifocal Leukoencephalopathy	1
Not Available	Recruiting	Treatment	Leukemias	1
Not Available	Terminated	Not Available	Chronic Hepatitis C Virus (HCV) Infection / Hepatitis C Viral Infection	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Physicians Total Care Inc.
Schering Corp.
Schering-Plough Inc.

Dosage forms

Form	Route	Strength
Injection, solution	Intralesional; Intramuscular; Subcutaneous	19.2 ug/0.5mL
Injection, solution	Intramuscular; Subcutaneous	11.6 ug/0.5mL
Injection, solution	Subcutaneous	11.6 ug/0.2mL
Injection, solution	Subcutaneous	19.2 ug/0.2mL
Injection, solution	Subcutaneous	38.4 ug/0.2mL
Kit		192 ug/1mL
Kit		38 ug/1mL
Kit		69 ug/1mL
Kit; liquid; powder, for solution	Intralesional; Intramuscular; Intravenous; Subcutaneous
Liquid	Subcutaneous	15000000 unit
Liquid	Subcutaneous	25000000 unit
Liquid	Subcutaneous	50000000 unit
Liquid; powder, for solution	Intralesional; Intramuscular; Intravenous; Subcutaneous
Solution	Intramuscular; Intravenous; Subcutaneous	10000000 unit
Solution	Intramuscular; Intravenous; Subcutaneous	6000000 unit
Liquid; powder, for solution	Intralesional; Intramuscular; Subcutaneous
Liquid	Intralesional; Intramuscular; Subcutaneous	5000000 unit
Liquid	Subcutaneous	10000000 unit
Liquid	Subcutaneous	3000000 unit
Liquid	Subcutaneous	5000000 unit
Capsule; kit; liquid	Oral; Subcutaneous

Prices

Unit description	Cost	Unit
Intron-A 10000000 unit/0.2ml Kit (each Box Contains One 6 Dose 1.5ml Pen)	1110.84USD	box
Intron a 10 million unit pen	1068.12USD	pen
Intron-A 5000000 unit/0.2ml Kit Box	683.34USD	box
Intron a 5 million unit/ml pen	657.06USD	pen
Intron a 3 million unit/ml pen	394.21USD	pen

DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
CA1341567	No	2008-02-19	2025-02-19
CA2201749	No	1999-06-15	2015-10-10

Properties

State

Liquid

Experimental Properties

Property	Value	Source
melting point (°C)	61 °C	Beldarrain, A. et al., Biochemistry 38:7865-7873 (1999)
hydrophobicity	-0.339	Not Available
isoelectric point	5.99	Not Available

Taxonomy

Description: Not Available
Kingdom: Organic Compounds
Super Class: Organic Acids
Class: Carboxylic Acids and Derivatives
Sub Class: Amino Acids, Peptides, and Analogues
Direct Parent: Peptides
Alternative Parents: Not Available
Substituents: Not Available
Molecular Framework: Not Available
External Descriptors: Not Available

Targets

Details1. Interferon alpha/beta receptor 2

Kind: Protein
Organism: Human
Pharmacological action: Yes
Actions: Binder

General Function: Type i interferon receptor activity
Specific Function: Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are direc...
Gene Name: IFNAR2
Uniprot ID: P48551
Uniprot Name: Interferon alpha/beta receptor 2
Molecular Weight: 57758.24 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Eid P, Tovey MG: Characterization of a domain of a human type I interferon receptor protein involved in ligand binding. J Interferon Cytokine Res. 1995 Mar;15(3):205-11. [PubMed:7584665]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Details2. Interferon alpha/beta receptor 1

Kind: Protein
Organism: Human
Pharmacological action: Yes
Actions: Binder

General Function: Type i interferon receptor activity
Specific Function: Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JA...
Gene Name: IFNAR1
Uniprot ID: P17181
Uniprot Name: Interferon alpha/beta receptor 1
Molecular Weight: 63524.81 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Khine AA, Lingwood CA: Functional significance of globotriaosyl ceramide in interferon-alpha(2)/type 1 interferon receptor-mediated antiviral activity. J Cell Physiol. 2000 Jan;182(1):97-108. [PubMed:10567921]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Enzymes

Details1. Cytochrome P450 1A2

Kind: Protein
Organism: Human
Pharmacological action: Unknown
Actions: Inhibitor

General Function: Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
Gene Name: CYP1A2
Uniprot ID: P05177
Uniprot Name: Cytochrome P450 1A2
Molecular Weight: 58293.76 Da

Drug created on June 13, 2005 07:24 / Updated on September 18, 2018 23:02