D(2) dopamine receptor

Details

Name
D(2) dopamine receptor
Synonyms
  • Dopamine D2 receptor
Gene Name
DRD2
Organism
Human
Amino acid sequence
>lcl|BSEQ0001508|D(2) dopamine receptor
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Number of residues
443
Molecular Weight
50618.91
Theoretical pI
9.85
GO Classification
Functions
drug binding / dopamine binding / identical protein binding / dopamine neurotransmitter receptor activity, coupled via Gi/Go / potassium channel regulator activity
Processes
adenohypophysis development / negative regulation of dopamine receptor signaling pathway / phospholipase C-activating dopamine receptor signaling pathway / positive regulation of glial cell-derived neurotrophic factor secretion / regulation of synaptic transmission, GABAergic / G-protein coupled receptor internalization / response to nicotine / arachidonic acid secretion / positive regulation of G-protein coupled receptor protein signaling pathway / prepulse inhibition / regulation of locomotion involved in locomotory behavior / negative regulation of dopamine secretion / response to cocaine / response to morphine / neurological system process involved in regulation of systemic arterial blood pressure / negative regulation of insulin secretion / behavioral response to ethanol / regulation of long-term neuronal synaptic plasticity / sensory perception of smell / response to toxic substance / response to drug / synaptic transmission, dopaminergic / protein localization / auditory behavior / response to inactivity / negative regulation of protein secretion / regulation of synapse structural plasticity / Wnt signaling pathway / negative regulation of adenylate cyclase activity / positive regulation of multicellular organism growth / regulation of phosphoprotein phosphatase activity / intracellular signal transduction / negative regulation of synaptic transmission, glutamatergic / negative regulation of voltage-gated calcium channel activity / branching morphogenesis of a nerve / axonogenesis / response to light stimulus / positive regulation of renal sodium excretion / regulation of cAMP metabolic process / positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway / temperature homeostasis / positive regulation of dopamine uptake involved in synaptic transmission / orbitofrontal cortex development / behavioral response to cocaine / negative regulation of protein kinase B signaling / cerebral cortex GABAergic interneuron migration / dopamine metabolic process / regulation of sodium ion transport / response to histamine / regulation of dopamine secretion / regulation of heart rate / negative regulation of cytosolic calcium ion concentration / pigmentation / positive regulation of growth hormone secretion / grooming behavior / adult walking behavior / positive regulation of cytokinesis / circadian regulation of gene expression / phosphatidylinositol metabolic process / synapse assembly / peristalsis / feeding behavior / positive regulation of long-term synaptic potentiation / locomotory behavior / long-term memory / positive regulation of neuroblast proliferation / associative learning / negative regulation of cell proliferation / positive regulation of ERK1 and ERK2 cascade / neuron-neuron synaptic transmission / regulation of potassium ion transport / negative regulation of circadian sleep/wake cycle, sleep / response to amphetamine / visual learning / cellular calcium ion homeostasis / positive regulation of urine volume / positive regulation of transcription from RNA polymerase II promoter / response to axon injury / negative regulation of innate immune response / release of sequestered calcium ion into cytosol / regulation of dopamine uptake involved in synaptic transmission / striatum development / response to iron ion / negative regulation of blood pressure / positive regulation of receptor internalization / response to hypoxia / negative regulation of cell migration / adenylate cyclase-inhibiting dopamine receptor signaling pathway / activation of protein kinase activity
Components
postsynaptic density / axon / axon terminus / perikaryon / intracellular / dendrite / dendritic spine / endocytic vesicle / plasma membrane / sperm flagellum / synaptic vesicle membrane / acrosomal vesicle / ciliary membrane / cytosol / lateral plasma membrane / nonmotile primary cilium / integral component of plasma membrane
General Function
Potassium channel regulator activity
Specific Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
Pfam Domain Function
Transmembrane Regions
38-60 71-93 109-130 152-172 189-213 374-395 410-431
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021274|D(2) dopamine receptor (DRD2)
ATGGATCCACTGAATCTGTCCTGGTATGATGATGATCTGGAGAGGCAGAACTGGAGCCGG
CCCTTCAACGGGTCAGACGGGAAGGCGGACAGACCCCACTACAACTACTATGCCACACTG
CTCACCCTGCTCATCGCTGTCATCGTCTTCGGCAACGTGCTGGTGTGCATGGCTGTGTCC
CGCGAGAAGGCGCTGCAGACCACCACCAACTACCTGATCGTCAGCCTCGCAGTGGCCGAC
CTCCTCGTCGCCACACTGGTCATGCCCTGGGTTGTCTACCTGGAGGTGGTAGGTGAGTGG
AAATTCAGCAGGATTCACTGTGACATCTTCGTCACTCTGGACGTCATGATGTGCACGGCG
AGCATCCTGAACTTGTGTGCCATCAGCATCGACAGGTACACAGCTGTGGCCATGCCCATG
CTGTACAATACGCGCTACAGCTCCAAGCGCCGGGTCACCGTCATGATCTCCATCGTCTGG
GTCCTGTCCTTCACCATCTCCTGCCCACTCCTCTTCGGACTCAATAACGCAGACCAGAAC
GAGTGCATCATTGCCAACCCGGCCTTCGTGGTCTACTCCTCCATCGTCTCCTTCTACGTG
CCCTTCATTGTCACCCTGCTGGTCTACATCAAGATCTACATTGTCCTCCGCAGACGCCGC
AAGCGAGTCAACACCAAACGCAGCAGCCGAGCTTTCAGGGCCCACCTGAGGGCTCCACTA
AAGGGCAACTGTACTCACCCCGAGGACATGAAACTCTGCACCGTTATCATGAAGTCTAAT
GGGAGTTTCCCAGTGAACAGGCGGAGAGTGGAGGCTGCCCGGCGAGCCCAGGAGCTGGAG
ATGGAGATGCTCTCCAGCACCAGCCCACCCGAGAGGACCCGGTACAGCCCCATCCCACCC
AGCCACCACCAGCTGACTCTCCCCGACCCGTCCCACCATGGTCTCCACAGCACTCCCGAC
AGCCCCGCCAAACCAGAGAAGAATGGGCATGCCAAAGACCACCCCAAGATTGCCAAGATC
TTTGAGATCCAGACCATGCCCAATGGCAAAACCCGGACCTCCCTCAAGACCATGAGCCGT
AGGAAGCTCTCCCAGCAGAAGGAGAAGAAAGCCACTCAGATGCTCGCCATTGTTCTCGGC
GTGTTCATCATCTGCTGGCTGCCCTTCTTCATCACACACATCCTGAACATACACTGTGAC
TGCAACATCCCGCCTGTCCTGTACAGCGCCTTCACGTGGCTGGGCTATGTCAACAGCGCC
GTGAACCCCATCATCTACACCACCTTCAACATTGAGTTCCGCAAGGCCTTCCTGAAGATC
CTCCACTGCTGA
Chromosome Location
11
Locus
11q23
External Identifiers
ResourceLink
UniProtKB IDP14416
UniProtKB Entry NameDRD2_HUMAN
GenBank Protein ID181432
GenBank Gene IDM30625
GenAtlas IDDRD2
HGNC IDHGNC:3023
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00248CabergolineapprovedyesagonistDetails
DB00268Ropiniroleapproved, investigationalyesagonistDetails
DB00391Sulpirideapproved, investigationalyesantagonistDetails
DB00420Promazineapproved, vet_approvedyesantagonistDetails
DB00433Prochlorperazineapproved, vet_approvedyesantagonistDetails
DB00450Droperidolapproved, vet_approvedyesantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedyesantagonistDetails
DB00502HaloperidolapprovedyesantagonistDetails
DB00623FluphenazineapprovedyesantagonistDetails
DB00714Apomorphineapproved, investigationalyesagonistDetails
DB00831Trifluoperazineapproved, investigationalyesantagonistDetails
DB00915AmantadineapprovedyesagonistDetails
DB00933Mesoridazineapproved, investigationalyesantagonistDetails
DB01063AcetophenazineapprovedyesantagonistDetails
DB01069Promethazineapproved, investigationalunknownantagonistDetails
DB01100PimozideapprovedyesantagonistDetails
DB01184Domperidoneapproved, investigational, vet_approvedyesantagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnyesagonistDetails
DB01200Bromocriptineapproved, investigationalyesagonistDetails
DB01238Aripiprazoleapproved, investigationalyesantagonistpartial agonistDetails
DB00246ZiprasidoneapprovedyesantagonistDetails
DB00334Olanzapineapproved, investigationalyesantagonistagonistDetails
DB00363ClozapineapprovedyesantagonistDetails
DB00372ThiethylperazinewithdrawnunknownantagonistDetails
DB00490Buspironeapproved, investigationalyesantagonistDetails
DB00508Triflupromazineapproved, vet_approvedyesantagonistDetails
DB00568Cinnarizineapproved, investigationalnoother/unknownDetails
DB00679Thioridazineapproved, withdrawnyesantagonistDetails
DB00734Risperidoneapproved, investigationalyesantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00805MinaprineapprovedunknownagonistDetails
DB00850PerphenazineapprovedyesantagonistDetails
DB00875Flupentixolapproved, investigational, withdrawnyesantagonistDetails
DB01224QuetiapineapprovedyesantagonistDetails
DB01233Metoclopramideapproved, investigationalyesantagonistDetails
DB01235LevodopaapprovedyesagonistDetails
DB01239Chlorprothixeneapproved, investigational, withdrawnyesantagonistDetails
DB01267PaliperidoneapprovedyesantagonistDetails
DB01624Zuclopenthixolapproved, investigationalyesantagonistDetails
DB01618MolindoneapprovedyesantagonistDetails
DB04842Fluspirileneapproved, investigationalyesantagonistDetails
DB00589Lisurideapproved, investigationalyesagonistDetails
DB00408LoxapineapprovedyesantagonistDetails
DB00413Pramipexoleapproved, investigationalyesagonistDetails
DB00409Remoxiprideapproved, withdrawnyesantagonistDetails
DB00696ErgotamineapprovedunknownagonistDetails
DB04857BrasofensineinvestigationalunknownDetails
DB04888BifeprunoxinvestigationalunknownDetails
DB04889BicifadineinvestigationalunknownDetails
DB06144Sertindoleapproved, investigational, withdrawnyesantagonistDetails
DB12061PardoprunoxinvestigationalunknownDetails
DB04924ItoprideinvestigationalunknownDetails
DB05316Pimavanserinapproved, investigationalunknownDetails
DB04946IloperidoneapprovedyesantagonistDetails
DB01038CarphenazinewithdrawnyesantagonistDetails
DB05687BL-1020investigationalunknownDetails
DB05766ACP-104investigationalunknownDetails
DB06077LumateperoneinvestigationalunknownDetails
DB06016Cariprazineapproved, investigationalyesagonistpartial agonistDetails
DB06216AsenapineapprovedyesantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB06477SumaniroleinvestigationalunknownDetails
DB04599AniracetamexperimentalunknownDetails
DB06288Amisulprideapproved, investigationalyesantagonistDetails
DB05271RotigotineapprovedyesagonistDetails
DB01403Methotrimeprazineapproved, investigationalyesantagonistDetails
DB01549Rolicyclidineexperimental, illicitunknownDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00726Trimipramineapprovedunknownother/unknownDetails
DB01392Yohimbineapproved, investigational, vet_approvedunknownantagonistDetails
DB01221Ketamineapproved, vet_approvedunknownagonistpartial agonistDetails
DB00988DopamineapprovedyesagonistDetails
DB01614Acepromazineapproved, vet_approvedyesantagonistDetails
DB01621Pipotiazineapproved, investigationalyesantagonistDetails
DB01622ThioproperazineapprovedyesantagonistDetails
DB01623ThiothixeneapprovedyesantagonistDetails
DB01425AlizaprideapprovedyesantagonistDetails
DB08815Lurasidoneapproved, investigationalyesantagonistDetails
DB04844Tetrabenazineapproved, investigationalunknowninhibitorDetails
DB00370MirtazapineapprovedunknowninhibitorbinderDetails
DB00182Amphetamineapproved, illicit, investigationalunknownbinderDetails
DB00458ImipramineapprovedunknownbinderDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB01043Memantineapproved, investigationalunknownagonistDetails
DB00934Maprotilineapproved, investigationalunknownbinderDetails
DB01151Desipramineapproved, investigationalunknownbinderDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB09018Bromoprideapproved, investigationalyesantagonistDetails
DB09207AS-8112experimentalunknownantagonistDetails
DB09128Brexpiprazoleapproved, investigationalyesagonistpartial agonistDetails
DB13025Tiaprideapproved, investigationalyesblockerDetails
DB08922PerospironeapprovedyesantagonistDetails
DB09097Quinagolideapproved, investigationalunknownagonistDetails
DB12478PiribedilinvestigationalunknownDetails
DB06454Sarizotaninvestigationalunknownpartial agonistDetails
DB12518RacloprideinvestigationalunknownantagonistDetails
DB12093TetrahydropalmatineinvestigationalunknownantagonistDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09223Blonanserinapproved, investigationalyesantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB09225Zotepineapproved, investigational, withdrawnyesantagonistDetails
DB09224Melperoneapproved, investigationalyesantagonistDetails
DB09286Pipamperoneapproved, investigationalunknownantagonistDetails
DB11274Dihydro-alpha-ergocryptineapprovedyesagonistDetails