Kappa-type opioid receptor

Details

Name
Kappa-type opioid receptor
Synonyms
  • K-OR-1
  • OPRK
Gene Name
OPRK1
Organism
Human
Amino acid sequence
>lcl|BSEQ0001260|Kappa-type opioid receptor
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Number of residues
380
Molecular Weight
42644.665
Theoretical pI
7.79
GO Classification
Functions
opioid receptor activity / neuropeptide binding / dynorphin receptor activity
Processes
maternal behavior / immune response / positive regulation of dopamine secretion / regulation of saliva secretion / response to ethanol / defense response to virus / phospholipase C-activating G-protein coupled receptor signaling pathway / regulation of sensory perception of pain / positive regulation of p38MAPK cascade / locomotory behavior / response to morphine / neuropeptide signaling pathway / sensory perception of temperature stimulus / positive regulation of potassium ion transmembrane transport / synaptic transmission / response to acrylamide / response to estrogen / behavioral response to cocaine / response to radiation / behavior / sensory perception / negative regulation of luteinizing hormone secretion / sensory perception of pain / eating behavior / regulation of aerobic respiration / adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / opioid receptor signaling pathway / cellular response to lipopolysaccharide / estrous cycle / adenylate cyclase-inhibiting opioid receptor signaling pathway / response to insulin / regulation of energy homeostasis / positive regulation of locomotion
Components
synapse / plasma membrane / neuron projection / perikaryon / integral component of membrane / integral component of plasma membrane / axon terminus / dendrite
General Function
Opioid receptor activity
Specific Function
G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. Also functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions.
Pfam Domain Function
Transmembrane Regions
58-85 96-119 133-154 174-196 223-247 275-296 312-333
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021645|Kappa-type opioid receptor (OPRK1)
ATGGACTCCCCGATCCAGATCTTCCGCGGGGAGCCGGGCCCTACCTGCGCCCCGAGCGCC
TGCCTGCCCCCCAACAGCAGCGCCTGGTTTCCCGGCTGGGCCGAGCCCGACAGCAACGGC
AGCGCCGGCTCGGAGGACGCGCAGCTGGAGCCCGCGCACATCTCCCCGGCCATCCCGGTC
ATCATCACGGCGGTCTACTCCGTAGTGTTCGTCGTGGGCTTGGTGGGCAACTCGCTGGTC
ATGTTCGTGATCATCCGATACACAAAGATGAAGACAGCAACCAACATTTACATATTTAAC
CTGGCTTTGGCAGATGCTTTAGTTACTACAACCATGCCCTTTCAGAGTACGGTCTACTTG
ATGAATTCCTGGCCTTTTGGGGATGTGCTGTGCAAGATAGTAATTTCCATTGATTACTAC
AACATGTTCACCAGCATCTTCACCTTGACCATGATGAGCGTGGACCGCTACATTGCCGTG
TGCCACCCCGTGAAGGCTTTGGACTTCCGCACACCCTTGAAGGCAAAGATCATCAATATC
TGCATCTGGCTGCTGTCGTCATCTGTTGGCATCTCTGCAATAGTCCTTGGAGGCACCAAA
GTCAGGGAAGACGTCGATGTCATTGAGTGCTCCTTGCAGTTCCCAGATGATGACTACTCC
TGGTGGGACCTCTTCATGAAGATCTGCGTCTTCATCTTTGCCTTCGTGATCCCTGTCCTC
ATCATCATCGTCTGCTACACCCTGATGATCCTGCGTCTCAAGAGCGTCCGGCTCCTTTCT
GGCTCCCGAGAGAAAGATCGCAACCTGCGTAGGATCACCAGACTGGTCCTGGTGGTGGTG
GCAGTCTTCGTCGTCTGCTGGACTCCCATTCACATATTCATCCTGGTGGAGGCTCTGGGG
AGCACCTCCCACAGCACAGCTGCTCTCTCCAGCTATTACTTCTGCATCGCCTTAGGCTAT
ACCAACAGTAGCCTGAATCCCATTCTCTACGCCTTTCTTGATGAAAACTTCAAGCGGTGT
TTCCGGGACTTCTGCTTTCCACTGAAGATGAGGATGGAGCGGCAGAGCACTAGCAGAGTC
CGAAATACAGTTCAGGATCCTGCTTACCTGAGGGACATCGATGGGATGAATAAACCAGTA
TGA
Chromosome Location
8
Locus
8q11.2
External Identifiers
ResourceLink
UniProtKB IDP41145
UniProtKB Entry NameOPRK_HUMAN
GenBank Protein ID532060
GenBank Gene IDU11053
GenAtlas IDOPRK1
HGNC IDHGNC:8154
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00454PethidineapprovedyesDetails
DB00611Butorphanolapproved, illicit, vet_approvedyesagonistDetails
DB00844NalbuphineapprovedyesagonistDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedyesantagonistDetails
DB00318Codeineapproved, illicityespartial agonistDetails
DB00327Hydromorphoneapproved, illicityesagonistDetails
DB00647Dextropropoxypheneapproved, illicit, withdrawnyesantagonistDetails
DB01209DezocineapprovedyesantagonistDetails
DB00652Pentazocineapproved, vet_approvedyesagonistDetails
DB00295Morphineapproved, investigationalyesagonistDetails
DB00370MirtazapineapprovedunknownagonistDetails
DB00704Naltrexoneapproved, investigational, vet_approvedyesantagonistDetails
DB015713-MethylfentanylillicityesagonistDetails
DB01497Etorphineillicit, vet_approvedyesagonistDetails
DB05046V1003investigationalunknownDetails
DB05104AsimadolineinvestigationalunknownDetails
DB05155CR665investigationalunknownDetails
DB05443ADL 10-0101investigationalunknownDetails
DB00497Oxycodoneapproved, illicit, investigationalyesagonistDetails
DB00193Tramadolapproved, investigationalunknownagonistDetails
DB06204TapentadolapprovedunknownDetails
DB01452Heroinapproved, illicitunknownagonistDetails
DB00708Sufentanilapproved, investigationalunknownotherDetails
DB01535Carfentanilillicit, vet_approvedunknownagonistDetails
DB00321AmitriptylineapprovedunknownagonistDetails
DB00854LevorphanolapprovedunknownagonistDetails
DB01565Dihydromorphineexperimental, illicitunknownagonistDetails
DB01183Naloxoneapproved, vet_approvedyesantagonistDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedunknownagonistDetails
DB00825MentholapprovedunknownagonistDetails
DB014393-Methylthiofentanylexperimental, illicityesagonistDetails
DB01548Diprenorphineillicit, vet_approvedunknownantagonistDetails
DB00836LoperamideapprovedyesagonistDetails
DB06274AlvimopanapprovedunknownantagonistDetails
DB00899RemifentanilapprovedunknownagonistDetails
DB06800MethylnaltrexoneapprovednoantagonistDetails
DB06738KetobemidoneapprovedyesagonistDetails
DB00514DextromethorphanapprovedunknownagonistDetails
DB00396Progesteroneapproved, vet_approvedunknownactivatorDetails
DB01221Ketamineapproved, vet_approvedunknownagonistDetails
DB06148MianserinapprovedunknownagonistDetails
DB09272EluxadolineapprovedyesagonistDetails
DB09396Propoxyphene napsylateapprovedyesagonistDetails
DB11691NaldemedineapprovedyesantagonistDetails