D(2) dopamine receptor
Details
- Name
- D(2) dopamine receptor
- Synonyms
- Dopamine D2 receptor
- Gene Name
- DRD2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0001508|D(2) dopamine receptor MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC
- Number of residues
- 443
- Molecular Weight
- 50618.91
- Theoretical pI
- 9.85
- GO Classification
- Functionsdopamine binding / dopamine neurotransmitter receptor activity, coupled via Gi/Go / drug binding / identical protein binding / potassium channel regulator activityProcessesactivation of protein kinase activity / adenohypophysis development / adenylate cyclase-inhibiting dopamine receptor signaling pathway / adult walking behavior / arachidonic acid secretion / associative learning / auditory behavior / axonogenesis / behavioral response to cocaine / behavioral response to ethanol / branching morphogenesis of a nerve / cellular calcium ion homeostasis / cerebral cortex GABAergic interneuron migration / circadian regulation of gene expression / dopamine metabolic process / feeding behavior / G-protein coupled receptor internalization / grooming behavior / intracellular signal transduction / locomotory behavior / long-term memory / negative regulation of adenylate cyclase activity / negative regulation of blood pressure / negative regulation of cell migration / negative regulation of cell proliferation / negative regulation of circadian sleep/wake cycle, sleep / negative regulation of cytosolic calcium ion concentration / negative regulation of dopamine receptor signaling pathway / negative regulation of dopamine secretion / negative regulation of innate immune response / negative regulation of insulin secretion / negative regulation of protein kinase B signaling / negative regulation of protein secretion / negative regulation of synaptic transmission, glutamatergic / negative regulation of voltage-gated calcium channel activity / neurological system process involved in regulation of systemic arterial blood pressure / neuron-neuron synaptic transmission / orbitofrontal cortex development / peristalsis / phosphatidylinositol metabolic process / phospholipase C-activating dopamine receptor signaling pathway / pigmentation / positive regulation of cytokinesis / positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway / positive regulation of dopamine uptake involved in synaptic transmission / positive regulation of ERK1 and ERK2 cascade / positive regulation of G-protein coupled receptor protein signaling pathway / positive regulation of glial cell-derived neurotrophic factor secretion / positive regulation of growth hormone secretion / positive regulation of long-term synaptic potentiation / positive regulation of multicellular organism growth / positive regulation of neuroblast proliferation / positive regulation of receptor internalization / positive regulation of renal sodium excretion / positive regulation of transcription from RNA polymerase II promoter / positive regulation of urine volume / prepulse inhibition / protein localization / regulation of cAMP metabolic process / regulation of dopamine secretion / regulation of dopamine uptake involved in synaptic transmission / regulation of heart rate / regulation of locomotion involved in locomotory behavior / regulation of long-term neuronal synaptic plasticity / regulation of phosphoprotein phosphatase activity / regulation of potassium ion transport / regulation of sodium ion transport / regulation of synapse structural plasticity / regulation of synaptic transmission, GABAergic / release of sequestered calcium ion into cytosol / response to amphetamine / response to axon injury / response to cocaine / response to drug / response to histamine / response to hypoxia / response to inactivity / response to iron ion / response to light stimulus / response to morphine / response to nicotine / response to toxic substance / sensory perception of smell / striatum development / synapse assembly / synaptic transmission, dopaminergic / temperature homeostasis / visual learning / Wnt signaling pathwayComponentsacrosomal vesicle / axon / axon terminus / ciliary membrane / cytosol / dendrite / dendritic spine / endocytic vesicle / integral component of plasma membrane / intracellular / lateral plasma membrane / nonmotile primary cilium / perikaryon / plasma membrane / postsynaptic density / sperm flagellum / synaptic vesicle membrane
- General Function
- Potassium channel regulator activity
- Specific Function
- Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 38-60 71-93 109-130 152-172 189-213 374-395 410-431
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0021274|D(2) dopamine receptor (DRD2) ATGGATCCACTGAATCTGTCCTGGTATGATGATGATCTGGAGAGGCAGAACTGGAGCCGG CCCTTCAACGGGTCAGACGGGAAGGCGGACAGACCCCACTACAACTACTATGCCACACTG CTCACCCTGCTCATCGCTGTCATCGTCTTCGGCAACGTGCTGGTGTGCATGGCTGTGTCC CGCGAGAAGGCGCTGCAGACCACCACCAACTACCTGATCGTCAGCCTCGCAGTGGCCGAC CTCCTCGTCGCCACACTGGTCATGCCCTGGGTTGTCTACCTGGAGGTGGTAGGTGAGTGG AAATTCAGCAGGATTCACTGTGACATCTTCGTCACTCTGGACGTCATGATGTGCACGGCG AGCATCCTGAACTTGTGTGCCATCAGCATCGACAGGTACACAGCTGTGGCCATGCCCATG CTGTACAATACGCGCTACAGCTCCAAGCGCCGGGTCACCGTCATGATCTCCATCGTCTGG GTCCTGTCCTTCACCATCTCCTGCCCACTCCTCTTCGGACTCAATAACGCAGACCAGAAC GAGTGCATCATTGCCAACCCGGCCTTCGTGGTCTACTCCTCCATCGTCTCCTTCTACGTG CCCTTCATTGTCACCCTGCTGGTCTACATCAAGATCTACATTGTCCTCCGCAGACGCCGC AAGCGAGTCAACACCAAACGCAGCAGCCGAGCTTTCAGGGCCCACCTGAGGGCTCCACTA AAGGGCAACTGTACTCACCCCGAGGACATGAAACTCTGCACCGTTATCATGAAGTCTAAT GGGAGTTTCCCAGTGAACAGGCGGAGAGTGGAGGCTGCCCGGCGAGCCCAGGAGCTGGAG ATGGAGATGCTCTCCAGCACCAGCCCACCCGAGAGGACCCGGTACAGCCCCATCCCACCC AGCCACCACCAGCTGACTCTCCCCGACCCGTCCCACCATGGTCTCCACAGCACTCCCGAC AGCCCCGCCAAACCAGAGAAGAATGGGCATGCCAAAGACCACCCCAAGATTGCCAAGATC TTTGAGATCCAGACCATGCCCAATGGCAAAACCCGGACCTCCCTCAAGACCATGAGCCGT AGGAAGCTCTCCCAGCAGAAGGAGAAGAAAGCCACTCAGATGCTCGCCATTGTTCTCGGC GTGTTCATCATCTGCTGGCTGCCCTTCTTCATCACACACATCCTGAACATACACTGTGAC TGCAACATCCCGCCTGTCCTGTACAGCGCCTTCACGTGGCTGGGCTATGTCAACAGCGCC GTGAACCCCATCATCTACACCACCTTCAACATTGAGTTCCGCAAGGCCTTCCTGAAGATC CTCCACTGCTGA
- Chromosome Location
- 11
- Locus
- 11q23
- External Identifiers
Resource Link UniProtKB ID P14416 UniProtKB Entry Name DRD2_HUMAN GenBank Protein ID 181432 GenBank Gene ID M30625 GenAtlas ID DRD2 HGNC ID HGNC:3023 - General References
- Selbie LA, Hayes G, Shine J: The major dopamine D2 receptor: molecular analysis of the human D2A subtype. DNA. 1989 Nov;8(9):683-9. [Article]
- Dal Toso R, Sommer B, Ewert M, Herb A, Pritchett DB, Bach A, Shivers BD, Seeburg PH: The dopamine D2 receptor: two molecular forms generated by alternative splicing. EMBO J. 1989 Dec 20;8(13):4025-34. [Article]
- Robakis NK, Mohamadi M, Fu DY, Sambamurti K, Refolo LM: Human retina D2 receptor cDNAs have multiple polyadenylation sites and differ from a pituitary clone at the 5' non-coding region. Nucleic Acids Res. 1990 Mar 11;18(5):1299. [Article]
- Grandy DK, Marchionni MA, Makam H, Stofko RE, Alfano M, Frothingham L, Fischer JB, Burke-Howie KJ, Bunzow JR, Server AC, et al.: Cloning of the cDNA and gene for a human D2 dopamine receptor. Proc Natl Acad Sci U S A. 1989 Dec;86(24):9762-6. [Article]
- Stormann TM, Gdula DC, Weiner DM, Brann MR: Molecular cloning and expression of a dopamine D2 receptor from human retina. Mol Pharmacol. 1990 Jan;37(1):1-6. [Article]
- Selbie LA, Hayes G, Shine J: DNA homology screening: isolation and characterization of the human D2A dopamine receptor subtype. Adv Second Messenger Phosphoprotein Res. 1990;24:9-14. [Article]
- Araki K, Kuwano R, Morii K, Hayashi S, Minoshima S, Shimizu N, Katagiri T, Usui H, Kumanishi T, Takahashi Y: Structure and expression of human and rat D2 dopamine receptor genes. Neurochem Int. 1992 Jul;21(1):91-8. [Article]
- Dearry A, Falardeau P, Shores C, Caron MG: D2 dopamine receptors in the human retina: cloning of cDNA and localization of mRNA. Cell Mol Neurobiol. 1991 Oct;11(5):437-53. [Article]
- Seeman P, Ohara K, Ulpian C, Seeman MV, Jellinger K, Van Tol HH, Niznik HB: Schizophrenia: normal sequence in the dopamine D2 receptor region that couples to G-proteins. DNA polymorphisms in D2. Neuropsychopharmacology. 1993 Feb;8(2):137-42. [Article]
- Seeman P, Nam D, Ulpian C, Liu IS, Tallerico T: New dopamine receptor, D2(Longer), with unique TG splice site, in human brain. Brain Res Mol Brain Res. 2000 Mar 10;76(1):132-41. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Binda AV, Kabbani N, Levenson R: Regulation of dense core vesicle release from PC12 cells by interaction between the D2 dopamine receptor and calcium-dependent activator protein for secretion (CAPS). Biochem Pharmacol. 2005 May 15;69(10):1451-61. [Article]
- Lopez-Aranda MF, Acevedo MJ, Gutierrez A, Koulen P, Khan ZU: Role of a Galphai2 protein splice variant in the formation of an intracellular dopamine D2 receptor pool. J Cell Sci. 2007 Jul 1;120(Pt 13):2171-8. Epub 2007 Jun 5. [Article]
- Borroto-Escuela DO, Van Craenenbroeck K, Romero-Fernandez W, Guidolin D, Woods AS, Rivera A, Haegeman G, Agnati LF, Tarakanov AO, Fuxe K: Dopamine D2 and D4 receptor heteromerization and its allosteric receptor-receptor interactions. Biochem Biophys Res Commun. 2011 Jan 28;404(4):928-34. doi: 10.1016/j.bbrc.2010.12.083. Epub 2010 Dec 22. [Article]
- Albizu L, Holloway T, Gonzalez-Maeso J, Sealfon SC: Functional crosstalk and heteromerization of serotonin 5-HT2A and dopamine D2 receptors. Neuropharmacology. 2011 Sep;61(4):770-7. doi: 10.1016/j.neuropharm.2011.05.023. Epub 2011 May 27. [Article]
- Johnston CA, Siderovski DP: Structural basis for nucleotide exchange on G alpha i subunits and receptor coupling specificity. Proc Natl Acad Sci U S A. 2007 Feb 6;104(6):2001-6. Epub 2007 Jan 30. [Article]
- Johnston CA, Siderovski DP: Retraction for Johnston and Siderovski. Structural basis for nucleotide exchange on Galphai subunits and receptor coupling specificity. Proc Natl Acad Sci U S A. 2012 Jan 31;109(5):1808. [Article]
- Itokawa M, Arinami T, Futamura N, Hamaguchi H, Toru M: A structural polymorphism of human dopamine D2 receptor, D2(Ser311-->Cys). Biochem Biophys Res Commun. 1993 Nov 15;196(3):1369-75. [Article]
- Klein C, Brin MF, Kramer P, Sena-Esteves M, de Leon D, Doheny D, Bressman S, Fahn S, Breakefield XO, Ozelius LJ: Association of a missense change in the D2 dopamine receptor with myoclonus dystonia. Proc Natl Acad Sci U S A. 1999 Apr 27;96(9):5173-6. [Article]
- Johann M, Putzhammer A, Eichhammer P, Wodarz N: Association of the -141C Del variant of the dopamine D2 receptor (DRD2) with positive family history and suicidality in German alcoholics. Am J Med Genet B Neuropsychiatr Genet. 2005 Jan 5;132B(1):46-9. [Article]
- Klein C, Gurvich N, Sena-Esteves M, Bressman S, Brin MF, Ebersole BJ, Fink S, Forsgren L, Friedman J, Grimes D, Holmgren G, Kyllerman M, Lang AE, de Leon D, Leung J, Prioleau C, Raymond D, Sanner G, Saunders-Pullman R, Vieregge P, Wahlstrom J, Breakefield XO, Kramer PL, Ozelius LJ, Sealfon SC: Evaluation of the role of the D2 dopamine receptor in myoclonus dystonia. Ann Neurol. 2000 Mar;47(3):369-73. [Article]
- Bevilacqua L, Doly S, Kaprio J, Yuan Q, Tikkanen R, Paunio T, Zhou Z, Wedenoja J, Maroteaux L, Diaz S, Belmer A, Hodgkinson CA, Dell'osso L, Suvisaari J, Coccaro E, Rose RJ, Peltonen L, Virkkunen M, Goldman D: A population-specific HTR2B stop codon predisposes to severe impulsivity. Nature. 2010 Dec 23;468(7327):1061-6. doi: 10.1038/nature09629. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00248 Cabergoline approved yes agonist Details DB00268 Ropinirole approved, investigational yes agonist Details DB00391 Sulpiride approved, investigational yes antagonist Details DB00420 Promazine approved, vet_approved yes antagonist Details DB00433 Prochlorperazine approved, vet_approved yes antagonist Details DB00450 Droperidol approved, vet_approved yes antagonist Details DB00477 Chlorpromazine approved, investigational, vet_approved yes antagonist Details DB00502 Haloperidol approved yes antagonist Details DB00623 Fluphenazine approved yes antagonist Details DB00714 Apomorphine approved, investigational yes agonist Details DB00831 Trifluoperazine approved, investigational yes antagonist Details DB00915 Amantadine approved yes agonist Details DB00933 Mesoridazine approved, investigational yes antagonist Details DB01063 Acetophenazine approved yes antagonist Details DB01069 Promethazine approved, investigational unknown antagonist Details DB01100 Pimozide approved yes antagonist Details DB01184 Domperidone approved, investigational, vet_approved yes antagonist Details DB01186 Pergolide approved, investigational, vet_approved, withdrawn yes agonist Details DB01200 Bromocriptine approved, investigational, withdrawn yes agonist Details DB01238 Aripiprazole approved, investigational yes antagonistpartial agonist Details DB00246 Ziprasidone approved yes antagonist Details DB00334 Olanzapine approved, investigational yes antagonist Details DB00363 Clozapine approved yes antagonist Details DB00372 Thiethylperazine approved, withdrawn unknown antagonist Details DB00490 Buspirone approved, investigational yes antagonist Details DB00508 Triflupromazine approved, vet_approved yes antagonist Details DB00568 Cinnarizine approved, investigational no other/unknown Details DB00679 Thioridazine approved, withdrawn yes antagonist Details DB00777 Propiomazine approved unknown antagonist Details DB00805 Minaprine approved unknown agonist Details DB00850 Perphenazine approved yes antagonist Details DB00875 Flupentixol approved, investigational, withdrawn yes antagonist Details DB01224 Quetiapine approved yes antagonist Details DB01233 Metoclopramide approved, investigational yes antagonist Details DB01235 Levodopa approved yes agonist Details DB01239 Chlorprothixene approved, experimental, investigational, withdrawn yes antagonist Details DB01267 Paliperidone approved yes antagonist Details DB01624 Zuclopenthixol approved, investigational yes antagonist Details DB01618 Molindone approved yes antagonist Details DB04842 Fluspirilene approved, investigational yes antagonist Details DB00589 Lisuride approved, investigational yes agonist Details DB00408 Loxapine approved yes antagonist Details DB00413 Pramipexole approved, investigational yes agonist Details DB00409 Remoxipride approved, withdrawn yes antagonist Details DB00696 Ergotamine approved unknown agonist Details DB04857 Brasofensine investigational unknown Details DB04888 Bifeprunox investigational unknown Details DB04889 Bicifadine investigational unknown Details DB06144 Sertindole approved, investigational, withdrawn yes antagonist Details DB12061 Pardoprunox investigational unknown Details DB04924 Itopride investigational unknown Details DB04946 Iloperidone approved yes antagonist Details DB01038 Carphenazine withdrawn yes antagonist Details DB05687 BL-1020 investigational unknown Details DB05766 Norclozapine investigational unknown Details DB06077 Lumateperone approved, investigational yes partial agonist Details DB06109 YKP-1358 investigational unknown antagonist Details DB05964 Amitifadine investigational unknown Details DB06216 Asenapine approved yes antagonist Details DB06229 Ocaperidone investigational unknown Details DB06477 Sumanirole investigational unknown Details DB04599 Aniracetam experimental unknown Details DB06288 Amisulpride approved, investigational yes antagonist Details DB05271 Rotigotine approved yes agonist Details DB01403 Methotrimeprazine approved, investigational yes antagonist Details DB01549 Rolicyclidine experimental, illicit unknown Details DB00543 Amoxapine approved unknown antagonist Details DB00726 Trimipramine approved unknown other/unknown Details DB01392 Yohimbine approved, investigational, vet_approved unknown antagonist Details DB01221 Ketamine approved, vet_approved unknown agonistpartial agonist Details DB00988 Dopamine approved yes agonist Details DB01614 Acepromazine experimental, vet_approved yes antagonist Details DB01621 Pipotiazine approved, investigational yes antagonist Details DB01622 Thioproperazine experimental yes antagonist Details DB01623 Thiothixene approved yes antagonist Details DB01425 Alizapride investigational yes antagonist Details DB08815 Lurasidone approved, investigational yes antagonist Details DB04844 Tetrabenazine approved, investigational unknown inhibitor Details DB00182 Amphetamine approved, illicit, investigational unknown binder Details DB00458 Imipramine approved unknown binder Details DB00540 Nortriptyline approved unknown antagonist Details DB01043 Memantine approved, investigational unknown antagonistagonist Details DB00934 Maprotiline approved, investigational unknown binder Details DB01151 Desipramine approved, investigational unknown binder Details DB06148 Mianserin approved, investigational unknown antagonist Details DB09018 Bromopride investigational yes antagonist Details DB09207 AS-8112 experimental unknown antagonist Details DB09128 Brexpiprazole approved, investigational unknown partial agonist Details DB13025 Tiapride investigational yes blocker Details DB08922 Perospirone experimental yes antagonist Details DB09097 Quinagolide approved, investigational unknown agonist Details DB12478 Piribedil investigational unknown Details DB06454 Sarizotan investigational unknown partial agonist Details DB12518 Raclopride investigational unknown antagonist Details DB12093 Tetrahydropalmatine investigational unknown antagonist Details DB09194 Etoperidone withdrawn unknown antagonist Details DB09223 Blonanserin investigational yes antagonist Details DB00555 Lamotrigine approved, investigational unknown agonistinhibitor Details DB09225 Zotepine approved, investigational, withdrawn yes antagonist Details DB09224 Melperone investigational yes antagonist Details DB09286 Pipamperone investigational unknown antagonist Details DB11274 Dihydro-alpha-ergocryptine approved yes agonist Details DB12579 JNJ-37822681 investigational yes antagonist Details DB14185 Aripiprazole lauroxil approved, investigational yes partial agonist Details DB00715 Paroxetine approved, investigational unknown other/unknown Details DB01175 Escitalopram approved unknown inhibitor Details DB00734 Risperidone approved, investigational yes antagonist Details DB00320 Dihydroergotamine approved, investigational unknown agonist Details DB06016 Cariprazine approved, investigational unknown partial agonist Details DB13345 Dihydroergocristine approved, experimental yes antagonistagonist Details DB01049 Ergoloid mesylate approved yes antagonistagonist Details DB11275 Epicriptine approved yes agonist Details DB08804 Nandrolone decanoate approved, illicit unknown modulator Details