Voltage-dependent L-type calcium channel subunit alpha-1C

Details

Name
Voltage-dependent L-type calcium channel subunit alpha-1C
Synonyms
  • CACH2
  • CACN2
  • CACNL1A1
  • Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle
  • CCHL1A1
  • Voltage-gated calcium channel subunit alpha Cav1.2
Gene Name
CACNA1C
Organism
Human
Amino acid sequence
>lcl|BSEQ0037015|Voltage-dependent L-type calcium channel subunit alpha-1C
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQELVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNP
ETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVF
TSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSD
SSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPEL
LYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQH
YGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASE
DDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDST
FTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAWKLS
SNRERHVPMCEDLELRRDSGSAGTQAHCLLLRKANPSRCHSRESQAAMAGQEETSQDETY
EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRA
SFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPA
TPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLM
VPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESA
ADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSS
L
Number of residues
2221
Molecular Weight
248974.1
Theoretical pI
6.7
GO Classification
Functions
calmodulin binding / high voltage-gated calcium channel activity / voltage-gated calcium channel activity / alpha-actinin binding / metal ion binding
Processes
regulation of blood pressure / smooth muscle contraction involved in micturition / glucose homeostasis / regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion / axon guidance / adult walking behavior / regulation of organ growth / positive regulation of cytosolic calcium ion concentration / visual learning / energy reserve metabolic process / calcium ion import / regulation of insulin secretion / calcium ion-dependent exocytosis / synaptic transmission / calcium-mediated signaling using extracellular calcium source / insulin secretion / calcium ion transport into cytosol / regulation of vasoconstriction / cell communication by electrical coupling involved in cardiac conduction / membrane depolarization during action potential / small molecule metabolic process / growth hormone secretion
Components
cytoplasm / voltage-gated calcium channel complex / plasma membrane / caveolar macromolecular signaling complex / postsynaptic density / T-tubule / Z disc / integral component of membrane / dendritic shaft / neuronal cell body / cytosol
General Function
Voltage-gated calcium channel activity
Specific Function
Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1C gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1C subunit play an important role in excitation-contraction coupling in the heart. The various isoforms display marked differences in the sensitivity to DHP compounds. Binding of calmodulin or CABP1 at the same regulatory sites results in an opposit effects on the channel function.
Pfam Domain Function
Transmembrane Regions
125-143 161-181 194-212 233-251 271-290 381-405 525-543 559-578 587-605 616-634 654-673 729-753 901-919 936-955 988-1006 1014-1032 1052-1071 1162-1186 1240-1258 1274-1293 1302-1320 1373-1391 1411-1430 1500-1524
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0016091|Voltage-dependent L-type calcium channel subunit alpha-1C (CACNA1C)
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGGTTCCAACTAT
GGGAGCCCACGCCCCGCCCATGCCAACATGAATGCCAATGCGGCAGCGGGGCTGGCCCCT
GAGCACATCCCCACCCCGGGGGCTGCCCTGTCGTGGCAGGCGGCCATCGACGCAGCCCGG
CAGGCTAAGCTGATGGGCAGCGCTGGCAATGCGACCATCTCCACAGTCAGCTCCACGCAG
CGGAAGCGGCAGCAATATGGGAAACCCAAGAAGCAGGGCAGCACCACGGCCACACGCCCG
CCCCGAGCCCTGCTCTGCCTGACCCTGAAGAACCCCATCCGGAGGGCCTGCATCAGCATT
GTCGAATGGAAACCATTTGAAATAATTATTTTACTGACTATTTTTGCCAATTGTGTGGCC
TTAGCGATCTATATTCCCTTTCCAGAAGATGATTCCAACGCCACCAATTCCAACCTGGAA
CGAGTGGAATATCTCTTTCTCATAATTTTTACGGTGGAAGCGTTTTTAAAAGTAATCGCC
TATGGACTCCTCTTTCACCCCAATGCCTACCTCCGCAACGGCTGGAACCTACTAGATTTT
ATAATTGTGGTTGTGGGGCTTTTTAGTGCAATTTTAGAACAAGCAACCAAAGCAGATGGG
GCAAACGCTCTCGGAGGGAAAGGGGCCGGATTTGATGTGAAGGCGCTGAGGGCCTTCCGC
GTGCTGCGCCCCCTGCGGCTGGTGTCCGGAGTCCCAAGTCTCCAGGTGGTCCTGAATTCC
ATCATCAAGGCCATGGTCCCCCTGCTGCACATCGCCCTGCTTGTGCTGTTTGTCATCATC
ATCTACGCCATCATCGGCTTGGAGCTCTTCATGGGGAAGATGCACAAGACCTGCTACAAC
CAGGAGGGCATAGCAGATGTTCCAGCAGAAGATGACCCTTCCCCTTGTGCGCTGGAAACG
GGCCACGGGCGGCAGTGCCAGAACGGCACGGTGTGCAAGCCCGGCTGGGATGGTCCCAAG
CACGGCATCACCAACTTTGACAACTTTGCCTTCGCCATGCTCACGGTGTTCCAGTGCATC
ACCATGGAGGGCTGGACGGACGTGCTGTACTGGGTCAATGATGCCGTAGGAAGGGACTGG
CCCTGGATCTATTTTGTTACACTAATCATCATAGGGTCATTTTTTGTACTTAACTTGGTT
CTCGGTGTGCTTAGCGGAGAGTTTTCCAAAGAGAGGGAGAAGGCCAAGGCCCGGGGAGAT
TTCCAGAAGCTGCGGGAGAAGCAGCAGCTAGAAGAGGATCTCAAAGGCTACCTGGATTGG
ATCACTCAGGCCGAAGACATCGATCCTGAGAATGAGGACGAAGGCATGGATGAGGAGAAG
CCCCGAAACATGAGCATGCCCACCAGTGAGACCGAGTCCGTCAACACCGAAAACGTGGCT
GGAGGTGACATCGAGGGAGAAAACTGCGGGGCCAGGCTGGCCCACCGGATCTCCAAGTCA
AAGTTCAGCCGCTACTGGCGCCGGTGGAATCGGTTCTGCAGAAGGAAGTGCCGCGCCGCA
GTCAAGTCTAATGTCTTCTACTGGCTGGTGATTTTCCTGGTGTTCCTCAACACGCTCACC
ATTGCCTCTGAGCACTACAACCAGCCCAACTGGCTCACAGAAGTCCAAGACACGGCAAAC
AAGGCCCTGCTGGCCCTGTTCACGGCAGAGATGCTCCTGAAGATGTACAGCCTGGGCCTG
CAGGCCTACTTCGTGTCCCTCTTCAACCGCTTTGACTGCTTCGTCGTGTGTGGCGGCATC
CTGGAGACCATCCTGGTGGAGACCAAGATCATGTCCCCACTGGGCATCTCCGTGCTCAGA
TGCGTCCGGCTGCTGAGGATTTTCAAGATCACGAGGTACTGGAACTCCTTGAGCAACCTG
GTGGCATCCTTGCTGAACTCTGTGCGCTCCATCGCCTCCCTGCTCCTTCTCCTCTTCCTC
TTCATCATCATCTTCTCCCTCCTGGGGATGCAGCTCTTTGGAGGAAAGTTCAACTTTGAT
GAGATGCAGACCCGGAGGAGCACATTCGATAACTTCCCCCAGTCCCTCCTCACTGTGTTT
CAGATCCTGACCGGGGAGGACTGGAATTCGGTGATGTATGATGGGATCATGGCTTATGGC
GGCCCCTCTTTTCCAGGGATGTTAGTCTGTATTTACTTCATCATCCTCTTCATCTGTGGA
AACTATATCCTACTGAATGTGTTCTTGGCCATTGCTGTGGACAACCTGGCTGATGCTGAG
AGCCTCACATCTGCCCAAAAGGAGGAGGAAGAGGAGAAGGAGAGAAAGAAGCTGGCCAGG
ACTGCCAGCCCAGAGAAGAAACAAGAGTTGGTGGAGAAGCCGGCAGTGGGGGAATCCAAG
GAGGAGAAGATTGAGCTGAAATCCATCACGGCTGACGGAGAGTCTCCACCCGCCACCAAG
ATCAACATGGATGACCTCCAGCCCAATGAAAATGAGGATAAGAGCCCCTACCCCAACCCA
GAAACTACAGGAGAAGAGGATGAGGAGGAGCCAGAGATGCCTGTCGGCCCTCGCCCACGA
CCACTCTCTGAGCTTCACCTTAAGGAAAAGGCAGTGCCCATGCCAGAAGCCAGCGCGTTT
TTCATCTTCAGCTCTAACAACAGGTTTCGCCTCCAGTGCCACCGCATTGTCAATGACACG
ATCTTCACCAACCTGATCCTCTTCTTCATTCTGCTCAGCAGCATTTCCCTGGCTGCTGAG
GACCCGGTCCAGCACACCTCCTTCAGGAACCATATTCTGTTTTATTTTGATATTGTTTTT
ACCACCATTTTCACCATTGAAATTGCTCTGAAGATGACTGCTTATGGGGCTTTCTTGCAC
AAGGGTTCTTTCTGCCGGAACTACTTCAACATCCTGGACCTGCTGGTGGTCAGCGTGTCC
CTCATCTCCTTTGGCATCCAGTCCAGTGCAATCAATGTCGTGAAGATCTTGCGAGTCCTG
CGAGTACTCAGGCCCCTGAGGGCCATCAACAGGGCCAAGGGGCTAAAGCATGTGGTTCAG
TGTGTGTTTGTCGCCATCCGGACCATCGGGAACATCGTGATTGTCACCACCCTGCTGCAG
TTCATGTTTGCCTGCATCGGGGTCCAGCTCTTCAAGGGAAAGCTGTACACCTGTTCAGAC
AGTTCCAAGCAGACAGAGGCGGAATGCAAGGGCAACTACATCACGTACAAAGACGGGGAG
GTTGACCACCCCATCATCCAACCCCGCAGCTGGGAGAACAGCAAGTTTGACTTTGACAAT
GTTCTGGCAGCCATGATGGCCCTCTTCACCGTCTCCACCTTCGAAGGGTGGCCAGAGCTG
CTGTACCGCTCCATCGACTCCCACACGGAAGACAAGGGCCCCATCTACAACTACCGTGTG
GAGATCTCCATCTTCTTCATCATCTACATCATCATCATCGCCTTCTTCATGATGAACATC
TTCGTGGGCTTCGTCATCGTCACCTTTCAGGAGCAGGGGGAGCAGGAGTACAAGAACTGT
GAGCTGGACAAGAACCAGCGACAGTGCGTGGAATACGCCCTCAAGGCCCGGCCCCTGCGG
AGGTACATCCCCAAGAACCAGCACCAGTACAAAGTGTGGTACGTGGTCAACTCCACCTAC
TTCGAGTACCTGATGTTCGTCCTCATCCTGCTCAACACCATCTGCCTGGCCATGCAGCAC
TACGGCCAGAGCTGCCTGTTCAAAATCGCCATGAACATCCTCAACATGCTCTTCACTGGC
CTCTTCACCGTGGAGATGATCCTGAAGCTCATTGCCTTCAAACCCAAGCACTATTTCTGT
GATGCATGGAATACATTTGACGCCTTGATTGTTGTGGGTAGCATTGTTGATATAGCAATC
ACCGAGGTAAACCCAGCTGAACATACCCAATGCTCTCCCTCTATGAACGCAGAGGAAAAC
TCCCGCATCTCCATCACCTTCTTCCGCCTGTTCCGGGTCATGCGTCTGGTGAAGCTGCTG
AGCCGTGGGGAGGGCATCCGGACGCTGCTGTGGACCTTCATCAAGTCCTTCCAGGCCCTG
CCCTATGTGGCCCTCCTGATCGTGATGCTGTTCTTCATCTACGCGGTGATCGGGATGCAG
GTGTTTGGGAAAATTGCCCTGAATGATACCACAGAGATCAACCGGAACAACAACTTTCAG
ACCTTCCCCCAGGCCGTGCTGCTCCTCTTCAGGTGTGCCACCGGGGAGGCCTGGCAGGAC
ATCATGCTGGCCTGCATGCCAGGCAAGAAGTGTGCCCCAGAGTCCGAGCCCAGCAACAGC
ACGGAGGGTGAAACACCCTGTGGTAGCAGCTTTGCTGTCTTCTACTTCATCAGCTTCTAC
ATGCTCTGTGCCTTCCTGATCATCAACCTCTTTGTAGCTGTCATCATGGACAACTTTGAC
TACCTGACAAGGGACTGGTCCATCCTTGGTCCCCACCACCTGGATGAGTTTAAAAGAATC
TGGGCAGAGTATGACCCTGAAGCCAAGGGTCGTATCAAACACCTGGATGTGGTGACCCTC
CTCCGGCGGATTCAGCCGCCACTAGGTTTTGGGAAGCTGTGCCCTCACCGCGTGGCTTGC
AAACGCCTGGTCTCCATGAACATGCCTCTGAACAGCGACGGGACAGTCATGTTCAATGCC
ACCCTGTTTGCCCTGGTCAGGACGGCCCTGAGGATCAAAACAGAAGGGAACCTAGAACAA
GCCAATGAGGAGCTGCGGGCGATCATCAAGAAGATCTGGAAGCGGACCAGCATGAAGCTG
CTGGACCAGGTGGTGCCCCCTGCAGGTGATGATGAGGTCACCGTTGGCAAGTTCTACGCC
ACGTTCCTGATCCAGGAGTACTTCCGGAAGTTCAAGAAGCGCAAAGAGCAGGGCCTTGTG
GGCAAGCCCTCCCAGAGGAACGCGCTGTCTCTGCAGGCTGGCTTGCGCACACTGCATGAC
ATCGGGCCTGAGATCCGACGGGCCATCTCTGGAGATCTCACCGCTGAGGAGGAGCTGGAC
AAGGCCATGAAGGAGGCTGTGTCCGCTGCTTCTGAAGATGACATCTTCAGGAGGGCCGGT
GGCCTGTTCGGCAACCACGTCAGCTACTACCAAAGCGACGGCCGGAGCGCCTTCCCCCAG
ACCTTCACCACTCAGCGCCCGCTGCACATCAACAAGGCGGGCAGCAGCCAGGGCGACACT
GAGTCGCCATCCCACGAGAAGCTGGTGGACTCCACCTTCACCCCGAGCAGCTACTCGTCC
ACCGGCTCCAACGCCAACATCAACAACGCCAACAACACCGCCCTGGGTCGCCTCCCTCGC
CCCGCCGGCTACCCCAGCACGGTCAGCACTGTGGAGGGCCACGGGCCCCCCTTGTCCCCT
GCCATCCGGGTGCAGGAGGTGGCGTGGAAGCTCAGCTCCAACAGGTGCCACTCCCGGGAG
AGCCAGGCAGCCATGGCGGGTCAGGAGGAGACGTCTCAGGATGAGACCTATGAAGTGAAG
ATGAACCATGACACGGAGGCCTGCAGTGAGCCCAGCCTGCTCTCCACAGAGATGCTCTCC
TACCAGGATGACGAAAATCGGCAACTGACGCTCCCAGAGGAGGACAAGAGGGACATCCGG
CAATCTCCGAAGAGGGGTTTCCTCCGCTCTGCCTCACTAGGTCGAAGGGCCTCCTTCCAC
CTGGAATGTCTGAAGCGACAGAAGGACCGAGGGGGAGACATCTCTCAGAAGACAGTCCTG
CCCTTGCATCTGGTTCATCATCAGGCATTGGCAGTGGCAGGCCTGAGCCCCCTCCTCCAG
AGAAGCCATTCCCCTGCCTCATTCCCTAGGCCTTTTGCCACCCCACCAGCCACACCTGGC
AGCCGAGGCTGGCCCCCACAGCCCGTCCCCACCCTGCGGCTTGAGGGGGTCGAGTCCAGT
GAGAAACTCAACAGCAGCTTCCCATCCATCCACTGCGGCTCCTGGGCTGAGACCACCCCC
GGTGGCGGGGGCAGCAGCGCCGCCCGGAGAGTCCGGCCCGTCTCCCTCATGGTGCCCAGC
CAGGCTGGGGCCCCAGGGAGGCAGTTCCACGGCAGTGCCAGCAGCCTGGTGGAAGCGGTC
TTGATTTCAGAAGGACTGGGGCAGTTTGCTCAAGATCCCAAGTTCATCGAGGTCACCACC
CAGGAGCTGGCCGACGCCTGCGACATGACCATAGAGGAGATGGAGAGCGCGGCCGACAAC
ATCCTCAGCGGGGGCGCCCCACAGAGCCCCAATGGCGCCCTCTTACCCTTTGTGAACTGC
AGGGACGCGGGGCAGGACCGAGCCGGGGGCGAAGAGGACGCGGGCTGTGTGCGCGCGCGG
GGTCGACCGAGTGAGGAGGAGCTCCAGGACAGCAGGGTCTACGTCAGCAGCCTGTAG
Chromosome Location
12
Locus
12p13.3
External Identifiers
ResourceLink
UniProtKB IDQ13936
UniProtKB Entry NameCAC1C_HUMAN
GenBank Gene IDM92270
GenAtlas IDCACNA1C
HGNC IDHGNC:1390
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00622Nicardipineapproved, investigationalyesinhibitorDetails
DB00308IbutilideapprovedyesactivatorDetails
DB00653Magnesium sulfateapproved, investigational, vet_approvedunknownDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB00270Isradipineapproved, investigationalyesinhibitorDetails
DB00661VerapamilapprovedyesinhibitorDetails
DB04855DronedaroneapprovedunknownDetails
DB04920Clevidipineapproved, investigationalunknownDetails
DB00381AmlodipineapprovedyesinhibitorDetails
DB01023Felodipineapproved, investigationalyesinhibitorDetails
DB01115NifedipineapprovedyesinhibitorDetails
DB00393Nimodipineapproved, investigationalyesinhibitorDetails
DB00401NisoldipineapprovedyesinhibitorDetails
DB01054Nitrendipineapproved, investigationalyesinhibitorDetails
DB00568Cinnarizineapproved, investigationalyesinhibitorDetails
DB06712Nilvadipineapproved, investigationalyesinhibitorDetails
DB06751Drotaverineapproved, investigationalunknowninhibitorDetails
DB01373Calciumapproved, nutraceuticalyesligandDetails
DB00898EthanolapprovedunknownDetails
DB09227BarnidipineapprovedyesantagonistDetails
DB09229Aranidipineapproved, investigationalyesantagonistDetails
DB09235Efonidipineapproved, investigationalunknownDetails
DB09237Levamlodipineapproved, investigationalunknownantagonistDetails
DB11633Isavuconazoleapproved, investigationalnoinhibitorDetails
DB12278Propiverineapproved, investigationalyesantagonistDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium CitrateapprovedunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedyesinhibitorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09236Lacidipineapproved, investigationalyesantagonistDetails
DB09231Benidipineapproved, investigationalyesantagonistDetails
DB09232Cilnidipineapproved, investigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB00825MentholapprovedyesantagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails