Collagenase clostridium histolyticum

Identification

Name
Collagenase clostridium histolyticum
Accession Number
DB00048  (BTD00010, BIOD00010, DB11249)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

Collagenase clostridium histolyticum is an enzyme produced by the bacterium Clostridium histolyticum that dismantles collagen. It is used as a powder-and-solvent injection kit for the treatment of Dupuytren's contracture, a condition where the fingers bend towards the palm and cannot be fully straightened, and Peyronie's disease, a connective tissue disorder involving the growth of fibrous plaques in the soft tissue of the penis. BioSpecifics Technologies developed the preparation, which is manufactured and marketed by Auxilium Pharmaceuticals as Xiaflex in the US and by Sobi as Xiapex in Europe.

Protein structure
Db00048
Protein chemical formula
C5028H7666N1300O1564S21
Protein average weight
112023.2 Da
Sequences
> Collagenase Sequence 
MKRKCLSKRLMLAITMATIFTVNSTLPIYAAVDKNNATAAVQNESKRYTVSYLKTLNYYD
LVDLLVKTEIENLPDLFQYSSDAKEFYGNKTRMSFIMDEIGRRAPQYTEIDHKGIPTLVE
VVRAGFYLGFHNKELNEINKRSFKERVIPSILAIQKNPNFKLGTEVQDKIVSATGLLAGN
ETAPPEVVNNFTPILQDCIKNIDRYALDDLKSKALFNVLAAPTYDITEYLRATKEKPENT
PWYGKIDGFINELKKLALYGKINDNNSWIIDNGIYHIAPLGKLHSNNKIGIETLTEVMKV
YPYLSMQHLQSADQIKRHYDSKDAEGNKIPLDKFKKEGKEKYCPKTYTFDDGKVIIKAGA
RVEEEKVKRLYWASKEVNSQFFRVYGIDKPLEEGNPDDILTMVIYNSPEEYKLNSVLYGY
DTNNGGMYIEPEGTFFTYEREAQESTYTLEELFRHEYTHYLQGRYAVPGQWGRTKLYDND
RLTWYEEGGAELFAGSTRTSGILPRKSIVSNIHNTTRNNRYKLSDTVHSKYGASFEFYNY
ACMFMDYMYNKDMGILNKLNDLAKNNDVDGYDNYIRDLSSNYALNDKYQDHMQERIDNYE
NLTVPFVADDYLVRHAYKNPNEIYSEISEVAKLKDAKSEVKKSQYFSTFTLRGSYTGGAS
KGKLEDQKAMNKFIDDSLKKLDTYSWSGYKTLTAYFTNYKVDSSNRVTYDVVFHGYLPNE
GDSKNSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSY
DKVGTYTVKLKVTDDKGESSVSTTTAEIKDLSENKLPVIYMHVPKSGALNQKVVFYGKGT
YDPDGSIAGYQWDFGDGSDFSSEQNPSHVYTKKGEYTVTLRVMDSSGQMSEKTMKIKITD
PVYPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGY
GGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSVG
R
Download FASTA Format
Synonyms
  • Clostridium histolyticum enzymes
  • Collagenase
External IDs
AA-4500 / AA4500 / PF-5076985
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Collagenase SantylOintment250 [arb'U]/gTopicalHealthpoint2006-10-182017-06-30Us
Collagenase SantylOintment250 [arb'U]/gTopicalSmith & Nephew, Inc.2006-10-18Not applicableUs
SantylOintment250 unitTopicalSmith & Nephew, Inc.1994-12-31Not applicableCanada
XiaflexPowder, for solution0.9 mgIntralesionalEndo Ventures Ltd2012-11-14Not applicableCanada
XiaflexKitEndo Pharmaceuticals2010-02-22Not applicableUs
XiapexInjection, powder, for solution0.9 mgIntralesionalSwedish Orphan Biovitrum Ab2011-02-28Not applicableEu
International/Other Brands
Cordase / Santyl (Advance Biofactures Corp) / Xiapex (Sobi)
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Kimchi Vitamin chewable multivitaminCollagenase clostridium histolyticum (5.625 mg/1) + Cholecalciferol (.375 mg/1) + Folic Acid (.03 mg/1) + Lactic Acid (30 mg/1) + Nicotinamide (.045 mg/1) + Pyridoxine (.285 mg/1) + Riboflavin (.24 mg/1) + Thiamine (.195 mg/1) + Vitamin A (.675 mg/1) + Vitamin C (180 mg/1) + Vitamin E (1.875 mg/1)Tablet, chewableOralTobico2010-03-18Not applicableUs
Categories
UNII
9X7O8V25IT
CAS number
9001-12-1

Pharmacology

Indication

Used to promote debridement of necrotic tissue in the treatment of severe burns and dermal ulcers including decubitus ulcers.

Structured Indications
Pharmacodynamics

Used in the treatment of skin ulcers and sever burns, collagenase is able to digest collagen in necrotic tissue at physiological pH by hydrolyzing the peptide bonds of undenatured and denatured collagen. Collagenase thus contributes towards the formation of granulation tissue and subsequent epithelization of dermal ulcers and severely burned areas. The action of collagenase may remove substrates necessary for bacterial proliferation or may permit antibodies, leukocytes, and antibiotics better access to the infected area.

Mechanism of action

Collagenase is a protease that is specific to collagen. The triple helical region of interstitial collagens is highly resistant to most cell proteinases. However, during remodeling of the connective tissue in such processes as wound healing and metastasis, collagen becomes susceptible to cleavage by collagenases. Collagenase cleaves all 3 alpha helical chains of native Types I, II and III collagens at a single locus by hydrolyzing the peptide bond following the Gly residue of the sequence: Gly 775-(Ile or Leu) 776-(Ala or Leu) 777 located approximately three-fourths of the chain length from each N-terminus

TargetActionsOrganism
UCollagen alpha-1(I) chainNot AvailableHuman
UCollagen alpha-1(II) chainNot AvailableHuman
UCollagen alpha-1(III) chainNot AvailableHuman
UCollagen alpha-2(I) chainNot AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Collagenase clostridium histolyticum.Approved
AcenocoumarolThe risk or severity of adverse effects can be increased when Acenocoumarol is combined with Collagenase clostridium histolyticum.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Collagenase clostridium histolyticum.Approved, Vet Approved
AlprostadilThe risk or severity of adverse effects can be increased when Alprostadil is combined with Collagenase clostridium histolyticum.Approved, Investigational
AnagrelideThe risk or severity of adverse effects can be increased when Anagrelide is combined with Collagenase clostridium histolyticum.Approved
AncrodThe risk or severity of adverse effects can be increased when Ancrod is combined with Collagenase clostridium histolyticum.Investigational
AndrographolideThe risk or severity of adverse effects can be increased when Andrographolide is combined with Collagenase clostridium histolyticum.Investigational
Antithrombin III humanThe risk or severity of adverse effects can be increased when Antithrombin III human is combined with Collagenase clostridium histolyticum.Approved
ApixabanThe risk or severity of adverse effects can be increased when Apixaban is combined with Collagenase clostridium histolyticum.Approved
ArdeparinThe risk or severity of adverse effects can be increased when Ardeparin is combined with Collagenase clostridium histolyticum.Approved, Investigational, Withdrawn
ArgatrobanThe risk or severity of adverse effects can be increased when Argatroban is combined with Collagenase clostridium histolyticum.Approved, Investigational
AzelastineThe risk or severity of adverse effects can be increased when Azelastine is combined with Collagenase clostridium histolyticum.Approved
BecaplerminThe risk or severity of adverse effects can be increased when Becaplermin is combined with Collagenase clostridium histolyticum.Approved, Investigational
BeraprostThe risk or severity of adverse effects can be increased when Beraprost is combined with Collagenase clostridium histolyticum.Investigational
BivalirudinThe risk or severity of adverse effects can be increased when Bivalirudin is combined with Collagenase clostridium histolyticum.Approved, Investigational
BuflomedilThe risk or severity of adverse effects can be increased when Buflomedil is combined with Collagenase clostridium histolyticum.Experimental
ButylphthalideThe risk or severity of adverse effects can be increased when Butylphthalide is combined with Collagenase clostridium histolyticum.Investigational
CangrelorThe risk or severity of adverse effects can be increased when Cangrelor is combined with Collagenase clostridium histolyticum.Approved
CertoparinThe risk or severity of adverse effects can be increased when Certoparin is combined with Collagenase clostridium histolyticum.Approved, Investigational
CilostazolThe risk or severity of adverse effects can be increased when Cilostazol is combined with Collagenase clostridium histolyticum.Approved
Citric AcidThe risk or severity of adverse effects can be increased when Citric Acid is combined with Collagenase clostridium histolyticum.Approved, Nutraceutical, Vet Approved
ClopidogrelThe risk or severity of adverse effects can be increased when Clopidogrel is combined with Collagenase clostridium histolyticum.Approved, Nutraceutical
CloricromenThe risk or severity of adverse effects can be increased when Cloricromen is combined with Collagenase clostridium histolyticum.Experimental
Dabigatran etexilateThe risk or severity of adverse effects can be increased when Dabigatran etexilate is combined with Collagenase clostridium histolyticum.Approved
DalteparinThe risk or severity of adverse effects can be increased when Dalteparin is combined with Collagenase clostridium histolyticum.Approved
DanaparoidThe risk or severity of adverse effects can be increased when Danaparoid is combined with Collagenase clostridium histolyticum.Approved, Withdrawn
DarexabanThe risk or severity of adverse effects can be increased when Darexaban is combined with Collagenase clostridium histolyticum.Investigational
DefibrotideThe risk or severity of adverse effects can be increased when Defibrotide is combined with Collagenase clostridium histolyticum.Approved, Investigational
DesirudinThe risk or severity of adverse effects can be increased when Desirudin is combined with Collagenase clostridium histolyticum.Approved
DextranThe risk or severity of adverse effects can be increased when Dextran is combined with Collagenase clostridium histolyticum.Approved, Vet Approved
Dextran 40The risk or severity of adverse effects can be increased when Dextran 40 is combined with Collagenase clostridium histolyticum.Approved
Dextran 70The risk or severity of adverse effects can be increased when Dextran 70 is combined with Collagenase clostridium histolyticum.Approved
Dextran 75The risk or severity of adverse effects can be increased when Dextran 75 is combined with Collagenase clostridium histolyticum.Approved
DicoumarolThe risk or severity of adverse effects can be increased when Dicoumarol is combined with Collagenase clostridium histolyticum.Approved
DipyridamoleThe risk or severity of adverse effects can be increased when Dipyridamole is combined with Collagenase clostridium histolyticum.Approved
Edetic AcidThe risk or severity of adverse effects can be increased when Edetic Acid is combined with Collagenase clostridium histolyticum.Approved, Vet Approved
EdoxabanThe risk or severity of adverse effects can be increased when Edoxaban is combined with Collagenase clostridium histolyticum.Approved
EnoxaparinThe risk or severity of adverse effects can be increased when Enoxaparin is combined with Collagenase clostridium histolyticum.Approved
EpinastineThe risk or severity of adverse effects can be increased when Epinastine is combined with Collagenase clostridium histolyticum.Approved, Investigational
EplivanserinThe risk or severity of adverse effects can be increased when Eplivanserin is combined with Collagenase clostridium histolyticum.Investigational
eplivanserineThe risk or severity of adverse effects can be increased when eplivanserine is combined with Collagenase clostridium histolyticum.Investigational
EpoprostenolThe risk or severity of adverse effects can be increased when Epoprostenol is combined with Collagenase clostridium histolyticum.Approved
EptifibatideThe risk or severity of adverse effects can be increased when Eptifibatide is combined with Collagenase clostridium histolyticum.Approved, Investigational
Ethyl biscoumacetateThe risk or severity of adverse effects can be increased when Ethyl biscoumacetate is combined with Collagenase clostridium histolyticum.Withdrawn
Ferulic acidThe risk or severity of adverse effects can be increased when Ferulic acid is combined with Collagenase clostridium histolyticum.Experimental
FluindioneThe risk or severity of adverse effects can be increased when Fluindione is combined with Collagenase clostridium histolyticum.Investigational
FondaparinuxThe risk or severity of adverse effects can be increased when Fondaparinux is combined with Collagenase clostridium histolyticum.Investigational
Fondaparinux sodiumThe risk or severity of adverse effects can be increased when Fondaparinux sodium is combined with Collagenase clostridium histolyticum.Approved, Investigational
GabexateThe risk or severity of adverse effects can be increased when Gabexate is combined with Collagenase clostridium histolyticum.Investigational
HeparinThe risk or severity of adverse effects can be increased when Heparin is combined with Collagenase clostridium histolyticum.Approved, Investigational
HydroxytyrosolThe risk or severity of adverse effects can be increased when Hydroxytyrosol is combined with Collagenase clostridium histolyticum.Investigational
IbudilastThe risk or severity of adverse effects can be increased when Ibudilast is combined with Collagenase clostridium histolyticum.Approved, Investigational
Icosapent ethylThe risk or severity of adverse effects can be increased when Icosapent ethyl is combined with Collagenase clostridium histolyticum.Approved, Nutraceutical
IdraparinuxThe risk or severity of adverse effects can be increased when Idraparinux is combined with Collagenase clostridium histolyticum.Investigational
IfenprodilThe risk or severity of adverse effects can be increased when Ifenprodil is combined with Collagenase clostridium histolyticum.Approved, Investigational, Withdrawn
IfetrobanThe risk or severity of adverse effects can be increased when Ifetroban is combined with Collagenase clostridium histolyticum.Investigational
IloprostThe risk or severity of adverse effects can be increased when Iloprost is combined with Collagenase clostridium histolyticum.Approved, Investigational
IndobufenThe risk or severity of adverse effects can be increased when Indobufen is combined with Collagenase clostridium histolyticum.Investigational
KetanserinThe risk or severity of adverse effects can be increased when Ketanserin is combined with Collagenase clostridium histolyticum.Investigational
LepirudinThe risk or severity of adverse effects can be increased when Lepirudin is combined with Collagenase clostridium histolyticum.Approved
LetaxabanThe risk or severity of adverse effects can be increased when Letaxaban is combined with Collagenase clostridium histolyticum.Investigational
LinsidomineThe risk or severity of adverse effects can be increased when Linsidomine is combined with Collagenase clostridium histolyticum.Experimental
MelagatranThe risk or severity of adverse effects can be increased when Melagatran is combined with Collagenase clostridium histolyticum.Experimental
MilrinoneThe risk or severity of adverse effects can be increased when Milrinone is combined with Collagenase clostridium histolyticum.Approved
NadroparinThe risk or severity of adverse effects can be increased when Nadroparin is combined with Collagenase clostridium histolyticum.Approved
NafamostatThe risk or severity of adverse effects can be increased when Nafamostat is combined with Collagenase clostridium histolyticum.Approved, Investigational
NaftopidilThe risk or severity of adverse effects can be increased when Naftopidil is combined with Collagenase clostridium histolyticum.Investigational
NimesulideThe risk or severity of adverse effects can be increased when Nimesulide is combined with Collagenase clostridium histolyticum.Approved, Investigational, Withdrawn
NitroaspirinThe risk or severity of adverse effects can be increased when Nitroaspirin is combined with Collagenase clostridium histolyticum.Investigational
OtamixabanThe risk or severity of adverse effects can be increased when Otamixaban is combined with Collagenase clostridium histolyticum.Investigational
Pentaerythritol TetranitrateThe risk or severity of adverse effects can be increased when Pentaerythritol Tetranitrate is combined with Collagenase clostridium histolyticum.Approved
Pentosan PolysulfateThe risk or severity of adverse effects can be increased when Pentosan Polysulfate is combined with Collagenase clostridium histolyticum.Approved
PentoxifyllineThe risk or severity of adverse effects can be increased when Pentoxifylline is combined with Collagenase clostridium histolyticum.Approved, Investigational
PhenindioneThe risk or severity of adverse effects can be increased when Phenindione is combined with Collagenase clostridium histolyticum.Approved, Investigational
PhenprocoumonThe risk or severity of adverse effects can be increased when Phenprocoumon is combined with Collagenase clostridium histolyticum.Approved, Investigational
PicotamideThe risk or severity of adverse effects can be increased when Picotamide is combined with Collagenase clostridium histolyticum.Experimental
PrasugrelThe risk or severity of adverse effects can be increased when Prasugrel is combined with Collagenase clostridium histolyticum.Approved
Protein CThe risk or severity of adverse effects can be increased when Protein C is combined with Collagenase clostridium histolyticum.Approved
Protein S humanThe risk or severity of adverse effects can be increased when Protein S human is combined with Collagenase clostridium histolyticum.Approved
ProtocatechualdehydeThe risk or severity of adverse effects can be increased when Protocatechualdehyde is combined with Collagenase clostridium histolyticum.Approved
RamatrobanThe risk or severity of adverse effects can be increased when Ramatroban is combined with Collagenase clostridium histolyticum.Investigational
ResveratrolThe risk or severity of adverse effects can be increased when Resveratrol is combined with Collagenase clostridium histolyticum.Approved, Experimental, Investigational
ReviparinThe risk or severity of adverse effects can be increased when Reviparin is combined with Collagenase clostridium histolyticum.Approved, Investigational
RidogrelThe risk or severity of adverse effects can be increased when Ridogrel is combined with Collagenase clostridium histolyticum.Approved
RivaroxabanThe risk or severity of adverse effects can be increased when Rivaroxaban is combined with Collagenase clostridium histolyticum.Approved
SarpogrelateThe risk or severity of adverse effects can be increased when Sarpogrelate is combined with Collagenase clostridium histolyticum.Investigational
SevofluraneThe risk or severity of adverse effects can be increased when Sevoflurane is combined with Collagenase clostridium histolyticum.Approved, Vet Approved
SRT501The risk or severity of adverse effects can be increased when SRT501 is combined with Collagenase clostridium histolyticum.Investigational
SulodexideThe risk or severity of adverse effects can be increased when Sulodexide is combined with Collagenase clostridium histolyticum.Approved, Investigational
TesmilifeneThe risk or severity of adverse effects can be increased when Tesmilifene is combined with Collagenase clostridium histolyticum.Investigational
TicagrelorThe risk or severity of adverse effects can be increased when Ticagrelor is combined with Collagenase clostridium histolyticum.Approved
TiclopidineThe risk or severity of adverse effects can be increased when Ticlopidine is combined with Collagenase clostridium histolyticum.Approved
TirofibanThe risk or severity of adverse effects can be increased when Tirofiban is combined with Collagenase clostridium histolyticum.Approved
TranilastThe risk or severity of adverse effects can be increased when Tranilast is combined with Collagenase clostridium histolyticum.Approved, Investigational
TrapidilThe risk or severity of adverse effects can be increased when Trapidil is combined with Collagenase clostridium histolyticum.Approved
TriflusalThe risk or severity of adverse effects can be increased when Triflusal is combined with Collagenase clostridium histolyticum.Approved, Investigational
TroxerutinThe risk or severity of adverse effects can be increased when Troxerutin is combined with Collagenase clostridium histolyticum.Investigational
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Collagenase clostridium histolyticum.Approved
WarfarinThe risk or severity of adverse effects can be increased when Warfarin is combined with Collagenase clostridium histolyticum.Approved
XimelagatranThe risk or severity of adverse effects can be increased when Ximelagatran is combined with Collagenase clostridium histolyticum.Approved, Investigational, Withdrawn
Food Interactions
Not Available

References

Synthesis Reference

Hun-Chi Lin, Shau-Ping Lei, "Molecular cloning of the genes responsible for collagenase production from Clostridium histolyticum." U.S. Patent US5177017, issued December, 1972.

US5177017
General References
  1. Norris DB, Trudgill PW: Multiple forms of cyclohexanone oxygenase from Nocardia globerula CL1. Eur J Biochem. 1976 Mar 16;63(1):193-8. [PubMed:4312]
  2. Pajot P: Fluroescence of proteins in 6-M guanidine hydrochloride. A method for the quantitative determination of tryptophan. Eur J Biochem. 1976 Mar 16;63(1):263-9. [PubMed:4317]
External Links
KEGG Compound
C00816
PubChem Substance
46506485
Therapeutic Targets Database
DAP000965
PharmGKB
PA449107
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Collagenase
ATC Codes
M09AB02 — Collagenase clostridium histolyticumD03BA52 — Collagenase, combinationsD03BA02 — Collagenase
AHFS Codes
  • 44:00.00 — Enzymes
  • 84:92.00 — Misc. Skin and Mucous Membrane Agents
MSDS
Download (72.9 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedOtherDupuytren's Contracture1
1CompletedTreatmentCellulite / Edematous Fibrosclerotic Panniculopathy (EFP)1
1CompletedTreatmentChronic Total Occlusion (CTO)1
1CompletedTreatmentDiabetic Foot / Ulcus Cruris1
1RecruitingTreatmentLeiomyomas / Uterine Leiomyomas1
1, 2CompletedTreatmentAdhesion of Flexor Tendon of Hand1
2Active Not RecruitingTreatmentCellulite / Edematous Fibrosclerotic Panniculopathy (EFP)1
2CompletedTreatmentAdhesive Capsulitis / Adhesive Capsulitis of Shoulder2
2CompletedTreatmentCellulite / Edematous Fibrosclerotic Panniculopathy (EFP)1
2CompletedTreatmentChronic Coronary Total Occlusions1
2CompletedTreatmentDupuytren's Contracture1
2CompletedTreatmentDupuytren's Disease1
2CompletedTreatmentEdematous Fibrosclerotic Panniculopathy (EFP)1
2CompletedTreatmentLipomas2
2CompletedTreatmentPeyronie's Disease2
2Not Yet RecruitingTreatmentUrethral Strictures1
2RecruitingTreatmentCellulite / Edematous Fibrosclerotic Panniculopathy (EFP)1
2Unknown StatusTreatmentBurn's Associated Contracture1
2Unknown StatusTreatmentCellulite1
2WithdrawnTreatmentAdhesive Capsulitis / Adhesive Capsulitis of Shoulder1
2, 3SuspendedTreatmentUlcers1
3CompletedTreatmentAdvanced Dupuytren's Disease3
3CompletedTreatmentDupuytren's Contracture6
3CompletedTreatmentDupuytren's Disease1
3CompletedTreatmentPeyronie's Disease5
3WithdrawnTreatmentPressure Ulcers1
4Active Not RecruitingTreatmentDupuytren's Contracture1
4CompletedBasic ScienceImpaired Wound Healing / Scarring1
4CompletedDiagnosticDiabetic Foot Ulcers (DFU)1
4CompletedTreatmentDiabetic Foot Ulcers (DFU)1
4CompletedTreatmentDiabetic Foot Ulcers (DFU) / Diabetic Foot Wounds3
4CompletedTreatmentDiabetic Foot Ulcers (DFU) / Foot Wounds1
4CompletedTreatmentDiabetic Foot / Foot Ulcer, Diabetic1
4CompletedTreatmentDupuytren's Contracture1
4CompletedTreatmentDupuytren's Disease2
4RecruitingTreatmentDupuytren's Contracture1
4RecruitingTreatmentDupuytren's Contracture / Dupuytren's Disease of Finger1
4RecruitingTreatmentDupuytrens Contracture1
4SuspendedTreatmentPartial Thickness Burn1
4TerminatedTreatmentPressure Ulcers1
4WithdrawnTreatmentFoot Ulcer, Diabetic / Pressure Ulcers1
4WithdrawnTreatmentPartial Thickness Burn1
Not AvailableActive Not RecruitingNot AvailableDupuytren's Contracture1
Not AvailableCompletedNot AvailableDupuytren's Contracture1
Not AvailableCompletedNot AvailableFollow up to Acute Wound Scar Study1
Not AvailableCompletedTreatmentDupuytrens Contracture1
Not AvailableRecruitingNot AvailableDupuytren's Disease1
Not AvailableTerminatedTreatmentUlcers / Wounds1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
OintmentTopical250 [arb'U]/g
Tablet, chewableOral
OintmentTopical250 unit
Kit
Powder, for solutionIntralesional0.9 mg
Injection, powder, for solutionIntralesional0.9 mg
Prices
Unit descriptionCostUnit
Xiaflex 0.9 mg vial3900.0USD vial
Collagenase powder2432.7USD g
Santyl 250 unit/gm Ointment 15 gm Tube62.98USD tube
Santyl ointment4.13USD g
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.714Not Available
isoelectric point5.58Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Platelet-derived growth factor binding
Specific Function
Type I collagen is a member of group I collagen (fibrillar forming collagen).
Gene Name
COL1A1
Uniprot ID
P02452
Uniprot Name
Collagen alpha-1(I) chain
Molecular Weight
138941.105 Da
References
  1. Egeblad M, Shen HC, Behonick DJ, Wilmes L, Eichten A, Korets LV, Kheradmand F, Werb Z, Coussens LM: Type I collagen is a genetic modifier of matrix metalloproteinase 2 in murine skeletal development. Dev Dyn. 2007 Jun;236(6):1683-93. [PubMed:17440987]
  2. Lindsey ML, Yoshioka J, MacGillivray C, Muangman S, Gannon J, Verghese A, Aikawa M, Libby P, Krane SM, Lee RT: Effect of a cleavage-resistant collagen mutation on left ventricular remodeling. Circ Res. 2003 Aug 8;93(3):238-45. Epub 2003 Jul 10. [PubMed:12855673]
  3. Beare AH, O'Kane S, Krane SM, Ferguson MW: Severely impaired wound healing in the collagenase-resistant mouse. J Invest Dermatol. 2003 Jan;120(1):153-63. [PubMed:12535212]
  4. Chiu CJ, Chang ML, Chiang CP, Hahn LJ, Hsieh LL, Chen CJ: Interaction of collagen-related genes and susceptibility to betel quid-induced oral submucous fibrosis. Cancer Epidemiol Biomarkers Prev. 2002 Jul;11(7):646-53. [PubMed:12101112]
  5. Beare AH, Krane SM, Ferguson MW: Variable impairment of wound healing in the heterozygous collagenase-resistant mouse. Wound Repair Regen. 2005 Jan-Feb;13(1):27-40. [PubMed:15659034]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Platelet-derived growth factor binding
Specific Function
Type II collagen is specific for cartilaginous tissues. It is essential for the normal embryonic development of the skeleton, for linear growth and for the ability of cartilage to resist compressiv...
Gene Name
COL2A1
Uniprot ID
P02458
Uniprot Name
Collagen alpha-1(II) chain
Molecular Weight
141785.08 Da
References
  1. Fraser A, Fearon U, Billinghurst RC, Ionescu M, Reece R, Barwick T, Emery P, Poole AR, Veale DJ: Turnover of type II collagen and aggrecan in cartilage matrix at the onset of inflammatory arthritis in humans: relationship to mediators of systemic and local inflammation. Arthritis Rheum. 2003 Nov;48(11):3085-95. [PubMed:14613270]
  2. Imai K, Dalal SS, Hambor J, Mitchell P, Okada Y, Horton WC, D'Armiento J: Bone growth retardation in mouse embryos expressing human collagenase 1. Am J Physiol Cell Physiol. 2007 Oct;293(4):C1209-15. Epub 2007 Jul 25. [PubMed:17652426]
  3. Verstappen SM, Poole AR, Ionescu M, King LE, Abrahamowicz M, Hofman DM, Bijlsma JW, Lafeber FP: Radiographic joint damage in rheumatoid arthritis is associated with differences in cartilage turnover and can be predicted by serum biomarkers: an evaluation from 1 to 4 years after diagnosis. Arthritis Res Ther. 2006;8(1):R31. Epub 2006 Jan 10. [PubMed:16507130]
  4. Martin G, Bogdanowicz P, Domagala F, Ficheux H, Pujol JP: Articular chondrocytes cultured in hypoxia: their response to interleukin-1beta and rhein, the active metabolite of diacerhein. Biorheology. 2004;41(3-4):549-61. [PubMed:15299286]
  5. Pratta MA, Yao W, Decicco C, Tortorella MD, Liu RQ, Copeland RA, Magolda R, Newton RC, Trzaskos JM, Arner EC: Aggrecan protects cartilage collagen from proteolytic cleavage. J Biol Chem. 2003 Nov 14;278(46):45539-45. Epub 2003 Jul 30. [PubMed:12890681]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Platelet-derived growth factor binding
Specific Function
Collagen type III occurs in most soft connective tissues along with type I collagen. Involved in regulation of cortical development. Is the major ligand of GPR56 in the developing brain and binding...
Gene Name
COL3A1
Uniprot ID
P02461
Uniprot Name
Collagen alpha-1(III) chain
Molecular Weight
138564.005 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Cole WG, Chiodo AA, Lamande SR, Janeczko R, Ramirez F, Dahl HH, Chan D, Bateman JF: A base substitution at a splice site in the COL3A1 gene causes exon skipping and generates abnormal type III procollagen in a patient with Ehlers-Danlos syndrome type IV. J Biol Chem. 1990 Oct 5;265(28):17070-7. [PubMed:2145268]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Protein binding, bridging
Specific Function
Type I collagen is a member of group I collagen (fibrillar forming collagen).
Gene Name
COL1A2
Uniprot ID
P08123
Uniprot Name
Collagen alpha-2(I) chain
Molecular Weight
129313.615 Da
References
  1. Chiu CJ, Chang ML, Chiang CP, Hahn LJ, Hsieh LL, Chen CJ: Interaction of collagen-related genes and susceptibility to betel quid-induced oral submucous fibrosis. Cancer Epidemiol Biomarkers Prev. 2002 Jul;11(7):646-53. [PubMed:12101112]

Drug created on June 13, 2005 07:24 / Updated on December 10, 2017 17:18