Prostaglandin G/H synthase 2

Details

Name
Prostaglandin G/H synthase 2
Synonyms
  • 1.14.99.1
  • COX-2
  • COX2
  • Cyclooxygenase-2
  • PGH synthase 2
  • PGHS-2
  • PHS II
  • Prostaglandin H2 synthase 2
  • Prostaglandin-endoperoxide synthase 2
Gene Name
PTGS2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0021832|Prostaglandin G/H synthase 2
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
Number of residues
604
Molecular Weight
68995.625
Theoretical pI
7.41
GO Classification
Functions
arachidonate 15-lipoxygenase activity / enzyme binding / heme binding / lipid binding / metal ion binding / peroxidase activity / prostaglandin-endoperoxide synthase activity
Processes
angiogenesis / arachidonic acid metabolic process / bone mineralization / brown fat cell differentiation / cellular response to ATP / cellular response to fluid shear stress / cellular response to hypoxia / cellular response to mechanical stimulus / cellular response to UV / cyclooxygenase pathway / decidualization / embryo implantation / hair cycle / inflammatory response / learning / lipoxygenase pathway / maintenance of blood-brain barrier / memory / movement of cell or subcellular component / NAD metabolic process / negative regulation of calcium ion transport / negative regulation of cell cycle / negative regulation of cell proliferation / negative regulation of smooth muscle contraction / negative regulation of synaptic transmission, dopaminergic / nicotinamide metabolic process / ovulation / positive regulation of apoptotic process / positive regulation of brown fat cell differentiation / positive regulation of cell migration involved in sprouting angiogenesis / positive regulation of fever generation / positive regulation of fibroblast growth factor production / positive regulation of NF-kappaB import into nucleus / positive regulation of nitric oxide biosynthetic process / positive regulation of platelet-derived growth factor production / positive regulation of prostaglandin biosynthetic process / positive regulation of smooth muscle cell proliferation / positive regulation of smooth muscle contraction / positive regulation of synaptic plasticity / positive regulation of synaptic transmission, glutamatergic / positive regulation of transforming growth factor beta production / positive regulation of vascular endothelial growth factor production / positive regulation of vasoconstriction / prostaglandin biosynthetic process / prostaglandin metabolic process / regulation of blood pressure / regulation of inflammatory response / response to drug / response to estradiol / response to fatty acid / response to fructose / response to glucocorticoid / response to lipopolysaccharide / response to lithium ion / response to manganese ion / response to oxidative stress / response to tumor necrosis factor / response to vitamin D / sensory perception of pain / small molecule metabolic process / vitamin metabolic process / water-soluble vitamin metabolic process
Components
caveola / cytoplasm / endoplasmic reticulum / endoplasmic reticulum lumen / endoplasmic reticulum membrane / neuron projection / nucleus / protein complex
General Function
Prostaglandin-endoperoxide synthase activity
Specific Function
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, phenotypic changes, resistance to apoptosis and tumor angiogenesis. In cancer cells, PTGS2 is a key step in the production of prostaglandin E2 (PGE2), which plays important roles in modulating motility, proliferation and resistance to apoptosis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Microsome membrane
Gene sequence
>lcl|BSEQ0021833|Prostaglandin G/H synthase 2 (PTGS2)
ATGCTCGCCCGCGCCCTGCTGCTGTGCGCGGTCCTGGCGCTCAGCCATACAGCAAATCCT
TGCTGTTCCCACCCATGTCAAAACCGAGGTGTATGTATGAGTGTGGGATTTGACCAGTAT
AAGTGCGATTGTACCCGGACAGGATTCTATGGAGAAAACTGCTCAACACCGGAATTTTTG
ACAAGAATAAAATTATTTCTGAAACCCACTCCAAACACAGTGCACTACATACTTACCCAC
TTCAAGGGATTTTGGAACGTTGTGAATAACATTCCCTTCCTTCGAAATGCAATTATGAGT
TATGTGTTGACATCCAGATCACATTTGATTGACAGTCCACCAACTTACAATGCTGACTAT
GGCTACAAAAGCTGGGAAGCCTTCTCTAACCTCTCCTATTATACTAGAGCCCTTCCTCCT
GTGCCTGATGATTGCCCGACTCCCTTGGGTGTCAAAGGTAAAAAGCAGCTTCCTGATTCA
AATGAGATTGTGGAAAAATTGCTTCTAAGAAGAAAGTTCATCCCTGATCCCCAGGGCTCA
AACATGATGTTTGCATTCTTTGCCCAGCACTTCACGCATCAGTTTTTCAAGACAGATCAT
AAGCGAGGGCCAGCTTTCACCAACGGGCTGGGCCATGGGGTGGACTTAAATCATATTTAC
GGTGAAACTCTGGCTAGACAGCGTAAACTGCGCCTTTTCAAGGATGGAAAAATGAAATAT
CAGATAATTGATGGAGAGATGTATCCTCCCACAGTCAAAGATACTCAGGCAGAGATGATC
TACCCTCCTCAAGTCCCTGAGCATCTACGGTTTGCTGTGGGGCAGGAGGTCTTTGGTCTG
GTGCCTGGTCTGATGATGTATGCCACAATCTGGCTGCGGGAACACAACAGAGTATGCGAT
GTGCTTAAACAGGAGCATCCTGAATGGGGTGATGAGCAGTTGTTCCAGACAAGCAGGCTA
ATACTGATAGGAGAGACTATTAAGATTGTGATTGAAGATTATGTGCAACACTTGAGTGGC
TATCACTTCAAACTGAAATTTGACCCAGAACTACTTTTCAACAAACAATTCCAGTACCAA
AATCGTATTGCTGCTGAATTTAACACCCTCTATCACTGGCATCCCCTTCTGCCTGACACC
TTTCAAATTCATGACCAGAAATACAACTATCAACAGTTTATCTACAACAACTCTATATTG
CTGGAACATGGAATTACCCAGTTTGTTGAATCATTCACCAGGCAAATTGCTGGCAGGGTT
GCTGGTGGTAGGAATGTTCCACCCGCAGTACAGAAAGTATCACAGGCTTCCATTGACCAG
AGCAGGCAGATGAAATACCAGTCTTTTAATGAGTACCGCAAACGCTTTATGCTGAAGCCC
TATGAATCATTTGAAGAACTTACAGGAGAAAAGGAAATGTCTGCAGAGTTGGAAGCACTC
TATGGTGACATCGATGCTGTGGAGCTGTATCCTGCCCTTCTGGTAGAAAAGCCTCGGCCA
GATGCCATCTTTGGTGAAACCATGGTAGAAGTTGGAGCACCATTCTCCTTGAAAGGACTT
ATGGGTAATGTTATATGTTCTCCTGCCTACTGGAAGCCAAGCACTTTTGGTGGAGAAGTG
GGTTTTCAAATCATCAACACTGCCTCAATTCAGTCTCTCATCTGCAATAACGTGAAGGGC
TGTCCCTTTACTTCATTCAGTGTTCCAGATCCAGAGCTCATTAAAACAGTCACCATCAAT
GCAAGTTCTTCCCGCTCCGGACTAGATGATATCAATCCCACAGTACTACTAAAAGAACGT
TCGACTGAACTGTAG
Chromosome Location
1
Locus
1q25.2-q25.3
External Identifiers
ResourceLink
UniProtKB IDP35354
UniProtKB Entry NamePGH2_HUMAN
GenBank Protein ID291988
GenBank Gene IDL15326
GenAtlas IDPTGS2
HGNC IDHGNC:9605
General References
  1. Jones DA, Carlton DP, McIntyre TM, Zimmerman GA, Prescott SM: Molecular cloning of human prostaglandin endoperoxide synthase type II and demonstration of expression in response to cytokines. J Biol Chem. 1993 Apr 25;268(12):9049-54. [PubMed:8473346]
  2. Hla T, Neilson K: Human cyclooxygenase-2 cDNA. Proc Natl Acad Sci U S A. 1992 Aug 15;89(16):7384-8. [PubMed:1380156]
  3. Kosaka T, Miyata A, Ihara H, Hara S, Sugimoto T, Takeda O, Takahashi E, Tanabe T: Characterization of the human gene (PTGS2) encoding prostaglandin-endoperoxide synthase 2. Eur J Biochem. 1994 May 1;221(3):889-97. [PubMed:8181472]
  4. Appleby SB, Ristimaki A, Neilson K, Narko K, Hla T: Structure of the human cyclo-oxygenase-2 gene. Biochem J. 1994 Sep 15;302 ( Pt 3):723-7. [PubMed:7945196]
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  6. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  8. Barnett J, Chow J, Ives D, Chiou M, Mackenzie R, Osen E, Nguyen B, Tsing S, Bach C, Freire J, et al.: Purification, characterization and selective inhibition of human prostaglandin G/H synthase 1 and 2 expressed in the baculovirus system. Biochim Biophys Acta. 1994 Nov 16;1209(1):130-9. [PubMed:7947975]
  9. Kim SF, Huri DA, Snyder SH: Inducible nitric oxide synthase binds, S-nitrosylates, and activates cyclooxygenase-2. Science. 2005 Dec 23;310(5756):1966-70. [PubMed:16373578]
  10. Sevigny MB, Li CF, Alas M, Hughes-Fulford M: Glycosylation regulates turnover of cyclooxygenase-2. FEBS Lett. 2006 Dec 11;580(28-29):6533-6. Epub 2006 Nov 9. [PubMed:17113084]
  11. Goodman JE, Bowman ED, Chanock SJ, Alberg AJ, Harris CC: Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk. Carcinogenesis. 2004 Dec;25(12):2467-72. Epub 2004 Aug 12. [PubMed:15308583]
  12. Smith WL, DeWitt DL, Garavito RM: Cyclooxygenases: structural, cellular, and molecular biology. Annu Rev Biochem. 2000;69:145-82. [PubMed:10966456]
  13. Sostres C, Gargallo CJ, Lanas A: Aspirin, cyclooxygenase inhibition and colorectal cancer. World J Gastrointest Pharmacol Ther. 2014 Feb 6;5(1):40-9. doi: 10.4292/wjgpt.v5.i1.40. [PubMed:24605250]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00154Dihomo-gamma-linolenic acidinvestigational, nutraceuticalyesDetails
DB00159Icosapentapproved, nutraceuticalyesinhibitorDetails
DB00480Lenalidomideapprovedunknownnegative modulatorDetails
DB00482Celecoxibapproved, investigationalyesinhibitorDetails
DB00533Rofecoxibapproved, investigational, withdrawnyesinhibitorDetails
DB00580Valdecoxibapproved, investigational, withdrawnyesinhibitorDetails
DB00605Sulindacapproved, investigationalyesinhibitorDetails
DB00712Flurbiprofenapproved, investigationalyesinhibitorDetails
DB00784Mefenamic acidapprovedyesinhibitorDetails
DB00812Phenylbutazoneapproved, vet_approvedyesinhibitorDetails
DB00821Carprofenapproved, vet_approved, withdrawnyesinhibitorDetails
DB00991OxaprozinapprovedyesinhibitorDetails
DB00244MesalazineapprovedyesinhibitorDetails
DB00316AcetaminophenapprovedyesinhibitorDetails
DB00328Indometacinapproved, investigationalyesinhibitorDetails
DB00461NabumetoneapprovedyesinhibitorDetails
DB00465KetorolacapprovedyesinhibitorDetails
DB00469TenoxicamapprovedyesinhibitorDetails
DB00500TolmetinapprovedyesinhibitorDetails
DB00573FenoprofenapprovedyesinhibitorDetails
DB00586Diclofenacapproved, vet_approvedyesinhibitorDetails
DB00749Etodolacapproved, investigational, vet_approvedyesinhibitorDetails
DB00788Naproxenapproved, vet_approvedyesinhibitorDetails
DB00814Meloxicamapproved, vet_approvedyesinhibitorDetails
DB00861Diflunisalapproved, investigationalyesinhibitorDetails
DB00870Suprofenapproved, withdrawnyesinhibitorDetails
DB00939Meclofenamic acidapproved, vet_approvedyesinhibitorDetails
DB00945Acetylsalicylic acidapproved, vet_approvedyesinhibitorDetails
DB00963BromfenacapprovedyesinhibitorDetails
DB01009Ketoprofenapproved, vet_approvedyesinhibitorDetails
DB01014Balsalazideapproved, investigationalyesinhibitorDetails
DB01050IbuprofenapprovedyesinhibitorDetails
DB01283Lumiracoxibapproved, investigationalyesinhibitorDetails
DB01399SalsalateapprovedyesinhibitorDetails
DB00936Salicylic acidapproved, investigational, vet_approvedyesinhibitorDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownantagonistDetails
DB01404Ginsengapproved, investigational, nutraceuticalunknowninhibitorDetails
DB01628Etoricoxibapproved, investigationalyesinhibitorDetails
DB01600Tiaprofenic acidapprovedyesinhibitorDetails
DB04743Nimesulideapproved, investigational, withdrawnyesinhibitorDetails
DB02709Resveratrolapproved, experimental, investigationalunknowninhibitorDetails
DB04725LicofeloneinvestigationalunknownDetails
DB05095CimicoxibinvestigationalunknownDetails
DB02266Flufenamic AcidapprovedunknownDetails
DB00554Piroxicamapproved, investigationalyesinhibitorDetails
DB01397Magnesium salicylateapprovedyesinhibitorDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownsubstrateDetails
DB06725Lornoxicamapproved, investigationalyesinhibitorDetails
DB03866Prostaglandin G2experimentalunknownDetails
DB034771-Phenylsulfonamide-3-Trifluoromethyl-5-ParabromophenylpyrazoleexperimentalunknownDetails
DB06802Nepafenacapproved, investigationalunknowninhibitorDetails
DB00795SulfasalazineapprovedyesinhibitorDetails
DB04552Niflumic AcidexperimentalyesinhibitorDetails
DB01435Antipyrineapproved, investigationalunknowninhibitorDetails
DB01419AntrafenineapprovedunknowninhibitorDetails
DB01401Choline magnesium trisalicylateapprovedunknowninhibitorDetails
DB00233Aminosalicylic AcidapprovedunknowninhibitorDetails
DB00963BromfenacapprovedunknowninhibitorDetails
DB00887BumetanideapprovedunknowninducerDetails
DB06774CapsaicinapprovedunknowninhibitorDetails
DB00856Chlorphenesinapproved, experimentalunknowninhibitorDetails
DB05095CimicoxibinvestigationalunknowninhibitorDetails
DB00720Clodronic acidapproved, investigational, vet_approvedunknowninhibitorDetails
DB06195SeliciclibinvestigationalunknowninhibitorDetails
DB00035DesmopressinapprovedunknowninducerDetails
DB05804Prasterone sulfateinvestigationalunknowninducerDetails
DB01395DrospirenoneapprovedunknowninhibitorDetails
DB06804Nonoxynol-9approved, withdrawnunknowninducerDetails
DB00515CisplatinapprovedunknowninhibitorDetails
DB00884Risedronic acidapproved, investigationalunknowninducerDetails
DB00360Sapropterinapproved, investigationalunknowninducerDetails
DB06436SemaxanibinvestigationalunknowninducerDetails
DB05875substance PinvestigationalunknowninducerDetails
DB00041AldesleukinapprovedunknowninducerDetails
DB00620Triamcinoloneapproved, vet_approvedunknowninhibitorDetails
DB08819TafluprostapprovedunknowninducerDetails
DB08910PomalidomideapprovedyesinhibitorDetails
DB00773EtoposideapprovedunknownsubstrateDetails
DB08439ParecoxibapprovedyesinhibitorDetails
DB09217Firocoxibexperimental, vet_approvedunknownDetails
DB13167Alclofenacapproved, withdrawnyesantagonistDetails
DB09213Dexibuprofenapproved, investigationalyesinhibitorDetails
DB11133Omega-3 fatty acidsapproved, nutraceuticalunknownsubstrateDetails
DB13168Omega-6 fatty acidsnutraceuticalunknownsubstrateDetails
DB06736Aceclofenacapproved, investigationalyesinhibitorDetails
DB13783Acemetacinapproved, experimental, investigationalyesantagonistDetails
DB09215DroxicamwithdrawnyesinhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB09212LoxoprofeninvestigationalyesantagonistDetails
DB09212LoxoprofeninvestigationalunknownsubstrateDetails
DB09216Tolfenamic Acidapproved, investigationalyesantagonistDetails
DB09214Dexketoprofenapproved, investigationalunknownantagonistDetails
DB09214Dexketoprofenapproved, investigationalunknowninhibitorDetails
DB09295TalniflumateexperimentalunknownantagonistDetails
DB09295TalniflumateexperimentalunknowninhibitorDetails
DB09285MorniflumateexperimentalunknownDetails
DB09285MorniflumateexperimentalunknowninhibitorDetails
DB09288PropacetamolexperimentalyesantagonistDetails
DB11079Trolamine salicylateapprovedyesinhibitorDetails
DB13257Ferrous sulfate anhydrousapprovedunknownDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB11071Phenyl salicylateapprovedunknownantagonistDetails
DB13346Bufexamacapproved, withdrawnyesinhibitorDetails
DB11327DipyrithioneapprovedunknownDetails
DB13961Fish oilapproved, nutraceuticalyesinhibitorDetails
DB11323Glycol salicylateapprovedyesantagonistDetails
DB11201Menthyl salicylateapprovedyesantagonistDetails
DB00210AdapaleneapprovedyesinhibitorDetails
DB13501Bendazacapproved, withdrawnunknownDetails