Multidrug resistance-associated protein 1

Details

Name
Multidrug resistance-associated protein 1
Synonyms
  • ATP-binding cassette sub-family C member 1
  • Leukotriene C(4) transporter
  • LTC4 transporter
  • MRP
  • MRP1
Gene Name
ABCC1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037076|Multidrug resistance-associated protein 1
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSD
LWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
ALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLF
SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
Number of residues
1531
Molecular Weight
171589.5
Theoretical pI
7.11
GO Classification
Functions
ATP binding / ATPase activity / ATPase activity, coupled to transmembrane movement of substances / transporter activity
Processes
arachidonic acid metabolic process / cobalamin metabolic process / leukotriene metabolic process / response to drug / small molecule metabolic process / transmembrane transport / transport / vitamin metabolic process / water-soluble vitamin metabolic process
Components
basolateral plasma membrane / extracellular exosome / integral component of plasma membrane / membrane / plasma membrane
General Function
Transporter activity
Specific Function
Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
Pfam Domain Function
Transmembrane Regions
34-54 75-95 101-121 134-154 173-193 317-337 364-384 441-461 465-485 548-568 591-611 968-988 1026-1046 1090-1110 1112-1132 1204-1224 1227-1247
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010554|Multidrug resistance-associated protein 1 (ABCC1)
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTC
ACGTGGAATACCAGCAACCCCGACTTCACCAAGTGCTTTCAGAACACGGTCCTCGTGTGG
GTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTG
CTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTCTTTCTGGGAAAGAAGTCGGGGCATA
TTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACT
TTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCATCCTGAGATCCAAAATTATGACAGCC
TTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAA
ACCATCCACGACCCTAATCCCTGCCCAGAGTCCAGCGCTTCCTTCCTGTCGAGGATCACC
TTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAAC
TGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCCGGTGAAGGTTGTGTACTCCTCCAAG
GATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACC
TTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAAGGCCATCCACGACCTGATGATGTTT
TCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTG
CTGCACCAGTACTTCCACATCTGCTTCGTCAGTGGCATGAGGATCAAGACCGCTGTCATT
GGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTAC
ATTAACATGATCTGGTCAGCCCCCCTGCAAGTCATCCTTGCTCTCTACCTCCTGTGGCTG
AATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAAT
CGGATCAAGCTGATGAACGAAATTCTCAATGGGATCAAAGTGCTAAAGCTTTATGCCTGG
GAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTG
GCCTTGTGCACATTTGCCGTCTACGTGACCATTGACGAGAACAACATCCTGGATGCCCAG
ACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTC
TCCCATGAGGAGCTGGAACCTGACAGCATCGAGCGACGGCCTGTCAAAGACGGCGGGGGC
ACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTG
GGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTTGGCTGAGATGGACAAAGTGGAGGGG
CACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTG
ATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAATCCTGCCCAGTGGGGATCGGACAGAG
ATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGG
GCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCC
CATGTGGGAAAACACATCTTTGAAAATGTGATTGGCCCCAAGGGGATGCTGAAGAACAAG
ACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGC
GCCTTCGCTGAGTTCCTGCGTACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAG
AACGGGGTCACGGGCGTCAGCGGTCCAGGGAAGGAAGCAAAGCAAATGGAGAATGGCATG
CTGGTGACGGACAGTGCAGGGAAGCAACTGCAGAGACAGCTCAGCAGCTCCTCCTCCTAT
AGTGGGGACATCAGCAGGCACCACAACAGCACCGCAGAACTGCAGAAAGCTGAGGCCAAG
AAGGAGGAGACCTGGAAGCTGATGGAGGCTGACAAGGCGCAGACAGGGCAGGTCAAGCTT
TCCGTGTACTGGGACTACATGAAGGCCATCGGACTCTTCATCTCCTTCCTCAGCATCTTC
CTTTTCATGTGTAACCATGTGTCCGCGCTGGCTTCCAACTATTGGCTCAGCCTCTGGACT
GATGACCCCATCGTCAACGGGACTCAGGAGCACACGAAAGTCCGGCTGAGCGTCTATGGA
GCCCTGGGCATTTCACAAGGGATCGCCGTGTTTGGCTACTCCATGGCCGTGTCCATCGGG
GGGATCTTGGCTTCCCGCTGTCTGCACGTGGACCTGCTGCACAGCATCCTGCGGTCACCC
ATGAGCTTCTTTGAGCGGACCCCCAGTGGGAACCTGGTGAACCGCTTCTCCAAGGAGCTG
GACACAGTGGACTCCATGATCCCGGAGGTCATCAAGATGTTCATGGGCTCCCTGTTCAAC
GTCATTGGTGCCTGCATCGTTATCCTGCTGGCCACGCCCATCGCCGCCATCATCATCCCG
CCCCTTGGCCTCATCTACTTCTTCGTCCAGAGGTTCTACGTGGCTTCCTCCCGGCAGCTG
AAGCGCCTCGAGTCGGTCAGCCGCTCCCCGGTCTATTCCCATTTCAACGAGACCTTGCTG
GGGGTCAGCGTCATTCGAGCCTTCGAGGAGCAGGAGCGCTTCATCCACCAGAGTGACCTG
AAGGTGGACGAGAACCAGAAGGCCTATTACCCCAGCATCGTGGCCAACAGGTGGCTGGCC
GTGCGGCTGGAGTGTGTGGGCAACTGCATCGTTCTGTTTGCTGCCCTGTTTGCGGTGATC
TCCAGGCACAGCCTCAGTGCTGGCTTGGTGGGCCTCTCAGTGTCTTACTCATTGCAGGTC
ACCACGTACTTGAACTGGCTGGTTCGGATGTCATCTGAAATGGAAACCAACATCGTGGCC
GTGGAGAGGCTCAAGGAGTATTCAGAGACTGAGAAGGAGGCGCCCTGGCAAATCCAGGAG
ACAGCTCCGCCCAGCAGCTGGCCCCAGGTGGGCCGAGTGGAATTCCGGAACTACTGCCTG
CGCTACCGAGAGGACCTGGACTTCGTTCTCAGGCACATCAATGTCACGATCAATGGGGGA
GAAAAGGTCGGCATCGTGGGGCGGACGGGAGCTGGGAAGTCGTCCCTGACCCTGGGCTTA
TTTCGGATCAACGAGTCTGCCGAAGGAGAGATCATCATCGATGGCATCAACATCGCCAAG
ATCGGCCTGCACGACCTCCGCTTCAAGATCACCATCATCCCCCAGGACCCTGTTTTGTTT
TCGGGTTCCCTCCGAATGAACCTGGACCCATTCAGCCAGTACTCGGATGAAGAAGTCTGG
ACGTCCCTGGAGCTGGCCCACCTGAAGGACTTCGTGTCAGCCCTTCCTGACAAGCTAGAC
CATGAATGTGCAGAAGGCGGGGAGAACCTCAGTGTCGGGCAGCGCCAGCTTGTGTGCCTA
GCCCGGGCCCTGCTGAGGAAGACGAAGATCCTTGTGTTGGATGAGGCCACGGCAGCCGTG
GACCTGGAAACGGACGACCTCATCCAGTCCACCATCCGGACACAGTTCGAGGACTGCACC
GTCCTCACCATCGCCCACCGGCTCAACACCATCATGGACTACACAAGGGTGATCGTCTTG
GACAAAGGAGAAATCCAGGAGTACGGCGCCCCATCGGACCTCCTGCAGCAGAGAGGTCTT
TTCTACAGCATGGCCAAAGACGCCGGCTTGGTGTGA
Chromosome Location
16
Locus
16p13.1
External Identifiers
ResourceLink
UniProtKB IDP33527
UniProtKB Entry NameMRP1_HUMAN
GenBank Protein ID1835659
GenBank Gene IDL05628
GenAtlas IDABCC1
HGNC IDHGNC:51
General References
  1. Cole SP, Bhardwaj G, Gerlach JH, Mackie JE, Grant CE, Almquist KC, Stewart AJ, Kurz EU, Duncan AM, Deeley RG: Overexpression of a transporter gene in a multidrug-resistant human lung cancer cell line. Science. 1992 Dec 4;258(5088):1650-4. [PubMed:1360704]
  2. Cole SP, Deeley RG: Multidrug resistance-associated protein: sequence correction. Science. 1993 May 14;260(5110):879. [PubMed:8098549]
  3. Grant CE, Kurz EU, Cole SP, Deeley RG: Analysis of the intron-exon organization of the human multidrug-resistance protein gene (MRP) and alternative splicing of its mRNA. Genomics. 1997 Oct 15;45(2):368-78. [PubMed:9344662]
  4. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  5. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [PubMed:10493829]
  6. Hipfner DR, Almquist KC, Leslie EM, Gerlach JH, Grant CE, Deeley RG, Cole SP: Membrane topology of the multidrug resistance protein (MRP). A study of glycosylation-site mutants reveals an extracytosolic NH2 terminus. J Biol Chem. 1997 Sep 19;272(38):23623-30. [PubMed:9295302]
  7. Kast C, Gros P: Topology mapping of the amino-terminal half of multidrug resistance-associated protein by epitope insertion and immunofluorescence. J Biol Chem. 1997 Oct 17;272(42):26479-87. [PubMed:9334225]
  8. Kast C, Gros P: Epitope insertion favors a six transmembrane domain model for the carboxy-terminal portion of the multidrug resistance-associated protein. Biochemistry. 1998 Feb 24;37(8):2305-13. [PubMed:9485377]
  9. Sjolinder M, Tornhamre S, Claesson HE, Hydman J, Lindgren J: Characterization of a leukotriene C4 export mechanism in human platelets: possible involvement of multidrug resistance-associated protein 1. J Lipid Res. 1999 Mar;40(3):439-46. [PubMed:10064732]
  10. Robbiani DF, Finch RA, Jager D, Muller WA, Sartorelli AC, Randolph GJ: The leukotriene C(4) transporter MRP1 regulates CCL19 (MIP-3beta, ELC)-dependent mobilization of dendritic cells to lymph nodes. Cell. 2000 Nov 22;103(5):757-68. [PubMed:11114332]
  11. Cui L, Hou YX, Riordan JR, Chang XB: Mutations of the Walker B motif in the first nucleotide binding domain of multidrug resistance protein MRP1 prevent conformational maturation. Arch Biochem Biophys. 2001 Aug 1;392(1):153-61. [PubMed:11469806]
  12. Ito K, Olsen SL, Qiu W, Deeley RG, Cole SP: Mutation of a single conserved tryptophan in multidrug resistance protein 1 (MRP1/ABCC1) results in loss of drug resistance and selective loss of organic anion transport. J Biol Chem. 2001 May 11;276(19):15616-24. Epub 2001 Feb 21. [PubMed:11278867]
  13. Zhang DW, Cole SP, Deeley RG: Identification of an amino acid residue in multidrug resistance protein 1 critical for conferring resistance to anthracyclines. J Biol Chem. 2001 Apr 20;276(16):13231-9. Epub 2001 Jan 23. [PubMed:11278596]
  14. Situ D, Haimeur A, Conseil G, Sparks KE, Zhang D, Deeley RG, Cole SP: Mutational analysis of ionizable residues proximal to the cytoplasmic interface of membrane spanning domain 3 of the multidrug resistance protein, MRP1 (ABCC1): glutamate 1204 is important for both the expression and catalytic activity of the transporter. J Biol Chem. 2004 Sep 10;279(37):38871-80. Epub 2004 Jun 18. [PubMed:15208328]
  15. Zhang DW, Nunoya K, Vasa M, Gu HM, Theis A, Cole SP, Deeley RG: Transmembrane helix 11 of multidrug resistance protein 1 (MRP1/ABCC1): identification of polar amino acids important for substrate specificity and binding of ATP at nucleotide binding domain 1. Biochemistry. 2004 Jul 27;43(29):9413-25. [PubMed:15260484]
  16. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  17. Conseil G, Deeley RG, Cole SP: Functional importance of three basic residues clustered at the cytosolic interface of transmembrane helix 15 in the multidrug and organic anion transporter MRP1 (ABCC1). J Biol Chem. 2006 Jan 6;281(1):43-50. Epub 2005 Oct 17. [PubMed:16230346]
  18. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976]
  19. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  20. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  21. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  22. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  23. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  24. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  25. Ramaen O, Leulliot N, Sizun C, Ulryck N, Pamlard O, Lallemand JY, Tilbeurgh Hv, Jacquet E: Structure of the human multidrug resistance protein 1 nucleotide binding domain 1 bound to Mg2+/ATP reveals a non-productive catalytic site. J Mol Biol. 2006 Jun 16;359(4):940-9. Epub 2006 May 2. [PubMed:16697012]
  26. Le Saux O, Urban Z, Tschuch C, Csiszar K, Bacchelli B, Quaglino D, Pasquali-Ronchetti I, Pope FM, Richards A, Terry S, Bercovitch L, de Paepe A, Boyd CD: Mutations in a gene encoding an ABC transporter cause pseudoxanthoma elasticum. Nat Genet. 2000 Jun;25(2):223-7. [PubMed:10835642]
  27. Ringpfeil F, Lebwohl MG, Christiano AM, Uitto J: Pseudoxanthoma elasticum: mutations in the MRP6 gene encoding a transmembrane ATP-binding cassette (ABC) transporter. Proc Natl Acad Sci U S A. 2000 May 23;97(11):6001-6. [PubMed:10811882]
  28. Conrad S, Kauffmann HM, Ito K, Deeley RG, Cole SP, Schrenk D: Identification of human multidrug resistance protein 1 (MRP1) mutations and characterization of a G671V substitution. J Hum Genet. 2001;46(11):656-63. [PubMed:11721885]
  29. Perdu J, Germain DP: Identification of novel polymorphisms in the pM5 and MRP1 (ABCC1) genes at locus 16p13.1 and exclusion of both genes as responsible for pseudoxanthoma elasticum. Hum Mutat. 2001;17(1):74-5. [PubMed:11139250]
  30. Ito S, Ieiri I, Tanabe M, Suzuki A, Higuchi S, Otsubo K: Polymorphism of the ABC transporter genes, MDR1, MRP1 and MRP2/cMOAT, in healthy Japanese subjects. Pharmacogenetics. 2001 Mar;11(2):175-84. [PubMed:11266082]
  31. Ley TJ, Mardis ER, Ding L, Fulton B, McLellan MD, Chen K, Dooling D, Dunford-Shore BH, McGrath S, Hickenbotham M, Cook L, Abbott R, Larson DE, Koboldt DC, Pohl C, Smith S, Hawkins A, Abbott S, Locke D, Hillier LW, Miner T, Fulton L, Magrini V, Wylie T, Glasscock J, Conyers J, Sander N, Shi X, Osborne JR, Minx P, Gordon D, Chinwalla A, Zhao Y, Ries RE, Payton JE, Westervelt P, Tomasson MH, Watson M, Baty J, Ivanovich J, Heath S, Shannon WD, Nagarajan R, Walter MJ, Link DC, Graubert TA, DiPersio JF, Wilson RK: DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome. Nature. 2008 Nov 6;456(7218):66-72. doi: 10.1038/nature07485. [PubMed:18987736]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01138SulfinpyrazoneapprovedyesinhibitorDetails
DB04851BiricodarinvestigationalunknownDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorinducerDetails
DB04216Quercetinexperimental, investigationalunknowninhibitorinducerDetails
DB00570VinblastineapprovedunknownsubstrateinhibitorinducerDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB04348Taurocholic AcidexperimentalunknowninhibitorinducerDetails
DB02659Cholic AcidapprovedunknowninducerDetails
DB01165OfloxacinapprovedunknowninhibitorDetails
DB01138SulfinpyrazoneapprovedunknowninhibitorDetails
DB00328Indometacinapproved, investigationalunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknowninhibitorDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB03467NaringeninexperimentalunknowninhibitorDetails
DB02375MyricetinexperimentalunknowninhibitorDetails
DB00709Lamivudineapproved, investigationalunknowninhibitorDetails
DB00224IndinavirapprovedunknowninhibitorDetails
DB00701Amprenavirapproved, investigationalunknowninhibitorDetails
DB01645GenisteininvestigationalunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB01050IbuprofenapprovedunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB00541Vincristineapproved, investigationalunknownsubstrateinhibitorDetails
DB00997Doxorubicinapproved, investigationalunknownsubstrateinhibitorDetails
DB00694DaunorubicinapprovedunknownsubstrateinhibitorDetails
DB01229Paclitaxelapproved, vet_approvedunknowninhibitorDetails
DB00143Glutathioneapproved, investigational, nutraceuticalunknownsubstrateinhibitorDetails
DB00563MethotrexateapprovedunknownsubstrateinhibitorDetails
DB01177IdarubicinapprovedunknowninhibitorDetails
DB00773EtoposideapprovedunknownsubstrateinhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB00834Mifepristoneapproved, investigationalunknowninhibitorDetails
DB01045RifampicinapprovedunknowninhibitorDetails
DB00602Ivermectinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB01204Mitoxantroneapproved, investigationalunknownsubstrateinhibitorDetails
DB05294VandetanibapprovedunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknownsubstrateDetails
DB00365Grepafloxacinapproved, investigational, withdrawnunknownsubstrateDetails
DB00693FluoresceinapprovedunknownsubstrateDetails
DB01232Saquinavirapproved, investigationalunknownsubstrateDetails
DB00445EpirubicinapprovedunknownsubstrateDetails
DB03825Rhodamine 6GexperimentalunknownsubstrateDetails
DB00970Dactinomycinapproved, investigationalunknownsubstrateDetails
DB01394ColchicineapprovedunknownsubstrateDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB00399Zoledronic acidapprovedunknownsubstrateDetails
DB01076AtorvastatinapprovedunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateDetails
DB01072Atazanavirapproved, investigationalunknownsubstrateinhibitorDetails
DB06335SaxagliptinapprovedunknownsubstrateDetails
DB05812AbirateroneapprovedunknowninhibitorDetails
DB08881VemurafenibapprovedunknownsubstrateinhibitorDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB09161Technetium Tc-99m sestamibiapproved, investigationalnosubstrateDetails
DB00171ATPinvestigational, nutraceuticalunknownDetails
DB08855Leukotriene C4experimental, investigationalunknownDetails
DB06176Romidepsinapproved, investigationalunknownDetails
DB13783Acemetacinapproved, experimental, investigationalnosubstrateDetails
DB09061Cannabidiolapproved, investigationalunknowninhibitorDetails
DB14011NabiximolsinvestigationalunknowninhibitorDetails
DB14009Medical Cannabisexperimental, investigationalunknowninhibitorDetails
DB09213Dexibuprofenapproved, investigationalunknownDetails
DB00115Cyanocobalaminapproved, nutraceuticalunknownDetails