Prostaglandin G/H synthase 1

Details

Name
Prostaglandin G/H synthase 1
Synonyms
  • 1.14.99.1
  • COX-1
  • COX1
  • Cyclooxygenase-1
  • PGH synthase 1
  • PGHS-1
  • PHS 1
  • Prostaglandin H2 synthase 1
  • Prostaglandin-endoperoxide synthase 1
Gene Name
PTGS1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0036935|Prostaglandin G/H synthase 1
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Number of residues
599
Molecular Weight
68685.82
Theoretical pI
7.39
GO Classification
Functions
dioxygenase activity / heme binding / lipid binding / metal ion binding / peroxidase activity / prostaglandin-endoperoxide synthase activity
Processes
aging / arachidonic acid metabolic process / cyclooxygenase pathway / inflammatory response / learning / lipid metabolic process / maintenance of blood-brain barrier / memory / negative regulation of epinephrine secretion / negative regulation of norepinephrine secretion / positive regulation of smooth muscle contraction / positive regulation of vasoconstriction / prostaglandin biosynthetic process / regulation of blood pressure / regulation of cell proliferation / response to corticosterone / response to fatty acid / response to organonitrogen compound / response to oxidative stress / sensory perception of pain / small molecule metabolic process / xenobiotic metabolic process
Components
cytoplasm / endoplasmic reticulum membrane / extracellular exosome / Golgi apparatus / intracellular membrane-bounded organelle / nuclear envelope / nucleus / photoreceptor outer segment
General Function
Prostaglandin-endoperoxide synthase activity
Specific Function
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Microsome membrane
Gene sequence
>lcl|BSEQ0021254|Prostaglandin G/H synthase 1 (PTGS1)
ATGAGCCGGAGTCTCTTGCTCTGGTTCTTGCTGTTCCTGCTCCTGCTCCCGCCGCTCCCC
GTCCTGCTCGCGGACCCAGGGGCGCCCACGCCAGTGAATCCCTGTTGTTACTATCCATGC
CAGCACCAGGGCATCTGTGTCCGCTTCGGCCTTGACCGCTACCAGTGTGACTGCACCCGC
ACGGGCTATTCCGGCCCCAACTGCACCATCCCTGGCCTGTGGACCTGGCTCCGGAATTCA
CTGCGGCCCAGCCCCTCTTTCACCCACTTCCTGCTCACTCACGGGCGCTGGTTCTGGGAG
TTTGTCAATGCCACCTTCATCCGAGAGATGCTCATGCGCCTGGTACTCACAGTGCGCTCC
AACCTTATCCCCAGTCCCCCCACCTACAACTCAGCACATGACTACATCAGCTGGGAGTCT
TTCTCCAACGTGAGCTATTACACTCGTATTCTGCCCTCTGTGCCTAAAGATTGCCCCACA
CCCATGGGAACCAAAGGGAAGAAGCAGTTGCCAGATGCCCAGCTCCTGGCCCGCCGCTTC
CTGCTCAGGAGGAAGTTCATACCTGACCCCCAAGGCACCAACCTCATGTTTGCCTTCTTT
GCACAACACTTCACCCACCAGTTCTTCAAAACTTCTGGCAAGATGGGTCCTGGCTTCACC
AAGGCCTTGGGCCATGGGGTAGACCTCGGCCACATTTATGGAGACAATCTGGAGCGTCAG
TATCAACTGCGGCTCTTTAAGGATGGGAAACTCAAGTACCAGGTGCTGGATGGAGAAATG
TACCCGCCCTCGGTAGAAGAGGCGCCTGTGTTGATGCACTACCCCCGAGGCATCCCGCCC
CAGAGCCAGATGGCTGTGGGCCAGGAGGTGTTTGGGCTGCTTCCTGGGCTCATGCTGTAT
GCCACGCTCTGGCTACGTGAGCACAACCGTGTGTGTGACCTGCTGAAGGCTGAGCACCCC
ACCTGGGGCGATGAGCAGCTTTTCCAGACGACCCGCCTCATCCTCATAGGGGAGACCATC
AAGATTGTCATCGAGGAGTACGTGCAGCAGCTGAGTGGCTATTTCCTGCAGCTGAAATTT
GACCCAGAGCTGCTGTTCGGTGTCCAGTTCCAATACCGCAACCGCATTGCCATGGAGTTC
AACCATCTCTACCACTGGCACCCCCTCATGCCTGACTCCTTCAAGGTGGGCTCCCAGGAG
TACAGCTACGAGCAGTTCTTGTTCAACACCTCCATGTTGGTGGACTATGGGGTTGAGGCC
CTGGTGGATGCCTTCTCTCGCCAGATTGCTGGCCGGATCGGTGGGGGCAGGAACATGGAC
CACCACATCCTGCATGTGGCTGTGGATGTCATCAGGGAGTCTCGGGAGATGCGGCTGCAG
CCCTTCAATGAGTACCGCAAGAGGTTTGGCATGAAACCCTACACCTCCTTCCAGGAGCTC
GTAGGAGAGAAGGAGATGGCAGCAGAGTTGGAGGAATTGTATGGAGACATTGATGCGTTG
GAGTTCTACCCTGGACTGCTTCTTGAAAAGTGCCATCCAAACTCTATCTTTGGGGAGAGT
ATGATAGAGATTGGGGCTCCCTTTTCCCTCAAGGGTCTCCTAGGGAATCCCATCTGTTCT
CCGGAGTACTGGAAGCCGAGCACATTTGGCGGCGAGGTGGGCTTTAACATTGTCAAGACG
GCCACACTGAAGAAGCTGGTCTGCCTCAACACCAAGACCTGTCCCTACGTTTCCTTCCGT
GTGCCGGATGCCAGTCAGGATGATGGGCCTGCTGTGGAGCGACCATCCACAGAGCTCTGA
Chromosome Location
9
Locus
9q32-q33.3
External Identifiers
ResourceLink
UniProtKB IDP23219
UniProtKB Entry NamePGH1_HUMAN
GenBank Protein ID387018
GenBank Gene IDM31822
GenAtlas IDPTGS1
HGNC IDHGNC:9604
General References
  1. Yokoyama C, Tanabe T: Cloning of human gene encoding prostaglandin endoperoxide synthase and primary structure of the enzyme. Biochem Biophys Res Commun. 1989 Dec 15;165(2):888-94. [PubMed:2512924]
  2. Funk CD, Funk LB, Kennedy ME, Pong AS, Fitzgerald GA: Human platelet/erythroleukemia cell prostaglandin G/H synthase: cDNA cloning, expression, and gene chromosomal assignment. FASEB J. 1991 Jun;5(9):2304-12. [PubMed:1907252]
  3. Takahashi Y, Ueda N, Yoshimoto T, Yamamoto S, Yokoyama C, Miyata A, Tanabe T, Fuse I, Hattori A, Shibata A: Immunoaffinity purification and cDNA cloning of human platelet prostaglandin endoperoxide synthase (cyclooxygenase). Biochem Biophys Res Commun. 1992 Jan 31;182(2):433-8. [PubMed:1734857]
  4. Diaz A, Reginato AM, Jimenez SA: Alternative splicing of human prostaglandin G/H synthase mRNA and evidence of differential regulation of the resulting transcripts by transforming growth factor beta 1, interleukin 1 beta, and tumor necrosis factor alpha. J Biol Chem. 1992 May 25;267(15):10816-22. [PubMed:1587858]
  5. Qin N, Zhang SP, Reitz TL, Mei JM, Flores CM: Cloning, expression, and functional characterization of human cyclooxygenase-1 splicing variants: evidence for intron 1 retention. J Pharmacol Exp Ther. 2005 Dec;315(3):1298-305. Epub 2005 Sep 1. [PubMed:16141368]
  6. Scott BT, Hasstedt SJ, Bovill EG, Callas PW, Valliere JE, Wang L, Wu KK, Long GL: Characterization of the human prostaglandin H synthase 1 gene (PTGS1): exclusion by genetic linkage analysis as a second modifier gene in familial thrombosis. Blood Coagul Fibrinolysis. 2002 Sep;13(6):519-31. [PubMed:12192304]
  7. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  8. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  10. Smith WL, DeWitt DL, Garavito RM: Cyclooxygenases: structural, cellular, and molecular biology. Annu Rev Biochem. 2000;69:145-82. [PubMed:10966456]
  11. Sostres C, Gargallo CJ, Lanas A: Aspirin, cyclooxygenase inhibition and colorectal cancer. World J Gastrointest Pharmacol Ther. 2014 Feb 6;5(1):40-9. doi: 10.4292/wjgpt.v5.i1.40. [PubMed:24605250]
  12. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  13. Goodman JE, Bowman ED, Chanock SJ, Alberg AJ, Harris CC: Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk. Carcinogenesis. 2004 Dec;25(12):2467-72. Epub 2004 Aug 12. [PubMed:15308583]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00244MesalazineapprovedyesinhibitorDetails
DB00316AcetaminophenapprovedyesinhibitorDetails
DB00328Indometacinapproved, investigationalunknowninhibitorDetails
DB00461NabumetoneapprovedunknowninhibitorDetails
DB00465KetorolacapprovedunknowninhibitorDetails
DB00469TenoxicamapprovedunknowninhibitorDetails
DB00500TolmetinapprovedunknowninhibitorDetails
DB00554Piroxicamapproved, investigationalunknowninhibitorDetails
DB00573FenoprofenapprovedunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedyesinhibitorDetails
DB00749Etodolacapproved, investigational, vet_approvedunknowninhibitorDetails
DB00788Naproxenapproved, vet_approvedyesinhibitorDetails
DB00861Diflunisalapproved, investigationalunknowninhibitorDetails
DB00870Suprofenapproved, withdrawnyesinhibitorDetails
DB00939Meclofenamic acidapproved, vet_approvedyesinhibitorDetails
DB00945Acetylsalicylic acidapproved, vet_approvedyesinhibitorDetails
DB00963BromfenacapprovedunknowninhibitorDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB01014Balsalazideapproved, investigationalyesinhibitorDetails
DB01050IbuprofenapprovedyesinhibitorDetails
DB00154Dihomo-gamma-linolenic acidinvestigational, nutraceuticalyesinhibitorDetails
DB00159Icosapentapproved, nutraceuticalyesinhibitorDetails
DB00712Flurbiprofenapproved, investigationalunknowninhibitorDetails
DB00784Mefenamic acidapprovedunknowninhibitorDetails
DB01399SalsalateapprovedyesinhibitorDetails
DB00350Minoxidilapproved, investigationalunknowninducerDetails
DB00605Sulindacapproved, investigationalunknowninhibitorDetails
DB00936Salicylic acidapproved, investigational, vet_approvedyesinhibitorDetails
DB01283Lumiracoxibapproved, investigationalyesinhibitorDetails
DB01837O-acetyl-L-serineexperimentalunknownDetails
DB02110Protoporphyrin Ix Containing CoexperimentalunknownDetails
DB021982-Bromoacetyl GroupexperimentalunknownDetails
DB03753Flurbiprofen Methyl EsterexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB04557Arachidonic AcidexperimentalunknownDetails
DB04817Metamizoleapproved, investigational, withdrawnunknownDetails
DB03783PhenacetinwithdrawnunknownDetails
DB01892HyperforinnutraceuticalunknowninhibitorDetails
DB02709Resveratrolapproved, experimental, investigationalunknowninhibitorDetails
DB12445NitroaspirininvestigationalunknowninhibitorDetails
DB00814Meloxicamapproved, vet_approvedunknowninhibitorDetails
DB02266Flufenamic AcidapprovedunknownDetails
DB00991OxaprozinapprovedyesinhibitorDetails
DB01600Tiaprofenic acidapprovedyesinhibitorDetails
DB01397Magnesium salicylateexperimentalyesinhibitorDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownsubstrateDetails
DB00711Diethylcarbamazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB06725Lornoxicamapproved, investigationalyesinhibitorDetails
DB00821Carprofenapproved, vet_approved, withdrawnunknowninhibitorDetails
DB00796Candesartan cilexetilapprovedunknownsubstrateDetails
DB01029Irbesartanapproved, investigationalunknownsubstrateDetails
DB01015SulfamethoxazoleapprovedunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateDetails
DB00619ImatinibapprovedunknownsubstrateDetails
DB05109Trabectedinapproved, investigationalunknownsubstrateDetails
DB00540NortriptylineapprovedunknownsubstrateDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00582Voriconazoleapproved, investigationalunknownsubstrateDetails
DB01075Diphenhydramineapproved, investigationalunknownsubstrateDetails
DB00216Eletriptanapproved, investigationalunknownsubstrateDetails
DB01355HexobarbitalexperimentalunknownsubstrateDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB01136Carvedilolapproved, investigationalunknownsubstrateDetails
DB00470Dronabinolapproved, illicitunknownsubstrateDetails
DB01198ZopicloneapprovedunknownsubstrateDetails
DB00471MontelukastapprovedunknownsubstrateDetails
DB00549Zafirlukastapproved, investigationalunknownsubstrateDetails
DB00744Zileutonapproved, investigational, withdrawnunknownsubstrateDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB00533Rofecoxibapproved, investigational, withdrawnunknownsubstrateDetails
DB01132Pioglitazoneapproved, investigationalunknownsubstrateDetails
DB00412Rosiglitazoneapproved, investigationalunknownsubstrateDetails
DB01221Ketamineapproved, vet_approvedunknownsubstrateDetails
DB00672Chlorpropamideapproved, investigationalunknownsubstrateDetails
DB00731Nateglinideapproved, investigationalunknownsubstrateDetails
DB06737ZaltoprofenexperimentalunknownsubstrateDetails
DB06739SeratrodastexperimentalunknownsubstrateDetails
DB06738KetobemidoneinvestigationalunknownsubstrateDetails
DB00812Phenylbutazoneapproved, vet_approvedyesinhibitorDetails
DB00402Eszopicloneapproved, investigationalunknownsubstrateDetails
DB02773(3-Chloro-4-Propoxy-Phenyl)-Acetic AcidexperimentalunknownDetails
DB020472-(1,1'-Biphenyl-4-Yl)Propanoic AcidexperimentalunknownDetails
DB079812-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1R)-1-(hydroxymethyl)propyl]acetamideexperimentalunknownDetails
DB079831-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACIDexperimentalunknownDetails
DB079842-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1S)-1-(hydroxymethyl)propyl]acetamideexperimentalunknownDetails
DB03752P-(2'-Iodo-5'-Thenoyl)Hydrotropic AcidexperimentalunknownDetails
DB03667Acetic Acid Salicyloyl-Amino-EsterexperimentalunknownDetails
DB06802Nepafenacapproved, investigationalunknowninhibitorDetails
DB00795SulfasalazineapprovedyesinhibitorDetails
DB01435Antipyrineapproved, investigationalunknowninhibitorDetails
DB01419AntrafenineapprovedunknowninhibitorDetails
DB01401Choline magnesium trisalicylateapprovedunknowninhibitorDetails
DB08814Triflusalapproved, investigationalyesantagonistDetails
DB04552Niflumic acidexperimentalunknownDetails
DB00035DesmopressinapprovedunknowninducerDetails
DB00773EtoposideapprovedunknownsubstrateDetails
DB09213Dexibuprofenapproved, investigationalunknowninhibitorDetails
DB06736Aceclofenacapproved, investigationalyesinhibitorDetails
DB13919CandesartanexperimentalunknownsubstrateDetails
DB13783Acemetacinapproved, investigationalyesantagonistDetails
DB09215DroxicamwithdrawnyesinhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB09212LoxoprofeninvestigationalyesantagonistDetails
DB09212LoxoprofeninvestigationalyessubstrateDetails
DB09216Tolfenamic Acidapproved, investigationalyesantagonistDetails
DB09214Dexketoprofenapproved, investigationalunknownantagonistDetails
DB09214Dexketoprofenapproved, investigationalunknowninhibitorDetails
DB09295TalniflumateexperimentalunknownantagonistDetails
DB09295TalniflumateexperimentalunknowninhibitorDetails
DB09288PropacetamolexperimentalyesantagonistDetails
DB11079Trolamine salicylateapprovedyesinhibitorDetails
DB13257Ferrous sulfate anhydrousapprovedunknownDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB11071Phenyl salicylateapprovedunknownantagonistDetails
DB13346Bufexamacapproved, withdrawnyesinhibitorDetails
DB11323Glycol salicylateapprovedyesantagonistDetails
DB11201Menthyl salicylateapprovedyesantagonistDetails
DB13501Bendazacapproved, withdrawnunknownDetails