Gamma-aminobutyric acid receptor subunit epsilon

Details

Name
Gamma-aminobutyric acid receptor subunit epsilon
Synonyms
  • GABA(A) receptor subunit epsilon
Gene Name
GABRE
Organism
Human
Amino acid sequence
>lcl|BSEQ0006923|Gamma-aminobutyric acid receptor subunit epsilon
MLSKVLPVLLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETE
TGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDI
IFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKD
GKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSW
KLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYVPSSVTTMLSWVSFW
IKTESAPARTSLGITSVLTMTTLGTFSRKNFPRVSYITALDFYIAICFVFCFCALLEFAV
LNFLIYNQTKAHASPKLRHPRINSRAHARTRARSRACARQHQEAFVCQIVTTEGSDGEER
PSCSAQQPPSPGSPEGPRSLCSKLACCEWCKRFKKYFCMVPDCEGSTWQQGRLCIHVYRL
DNYSRVVFPVTFFFFNVLYWLVCLNL
Number of residues
506
Molecular Weight
57971.175
Theoretical pI
8.09
GO Classification
Functions
chloride channel activity / GABA-A receptor activity / inhibitory extracellular ligand-gated ion channel activity
Processes
transport / chloride transmembrane transport / regulation of membrane potential / neurological system process / response to drug / gamma-aminobutyric acid signaling pathway / synaptic transmission
Components
postsynaptic membrane / chloride channel complex / GABA-A receptor complex / cell junction / integral component of plasma membrane / synapse / neuron projection
General Function
Inhibitory extracellular ligand-gated ion channel activity
Specific Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions
254-274 281-301 344-364 486-506
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0020703|Gamma-aminobutyric acid receptor subunit epsilon (GABRE)
ATGTTGTCCAAAGTTCTTCCAGTCCTCCTAGGCATCTTATTGATCCTCCAGTCGAGGGTC
GAGGGACCTCAGACTGAATCAAAGAATGAAGCCTCTTCCCGTGATGTTGTCTATGGCCCC
CAGCCCCAGCCTCTGGAAAATCAGCTCCTCTCTGAGGAAACAAAGTCAACTGAGACTGAG
ACTGGGAGCAGAGTTGGCAAACTGCCAGAAGCCTCTCGCATCCTGAACACTATCCTGAGT
AATTATGACCACAAACTGCGCCCTGGCATTGGAGAGAAGCCCACTGTGGTCACTGTTGAG
ATCTCCGTCAACAGCCTTGGTCCTCTCTCTATCCTAGACATGGAATACACCATTGACATC
ATCTTCTCCCAGACCTGGTACGACGAACGCCTCTGTTACAACGACACCTTTGAGTCTCTT
GTTCTGAATGGCAATGTGGTGAGCCAGCTATGGATCCCGGACACCTTTTTTAGGAATTCT
AAGAGGACCCACGAGCATGAGATCACCATGCCCAACCAGATGGTCCGCATCTACAAGGAT
GGCAAGGTGTTGTACACAATTAGGATGACCATTGATGCCGGATGCTCACTCCACATGCTC
AGATTTCCAATGGATTCTCACTCTTGCCCTCTATCTTTCTCTAGCTTTTCCTATCCTGAG
AATGAGATGATCTACAAGTGGGAAAATTTCAAGCTTGAAATCAATGAGAAGAACTCCTGG
AAGCTCTTCCAGTTTGATTTTACAGGAGTGAGCAACAAAACTGAAATAATCACAACCCCA
GTTGGTGACTTCATGGTCATGACGATTTTCTTCAATGTGAGCAGGCGGTTTGGCTATGTT
GCCTTTCAAAACTATGTCCCTTCTTCCGTGACCACGATGCTCTCCTGGGTTTCCTTTTGG
ATCAAGACAGAGTCTGCTCCAGCCCGGACCTCTCTAGGGATCACCTCTGTTCTGACCATG
ACCACGTTGGGCACCTTTTCTCGTAAGAATTTCCCGCGTGTCTCCTATATCACAGCCTTG
GATTTCTATATCGCCATCTGCTTCGTCTTCTGCTTCTGCGCTCTGTTGGAGTTTGCTGTG
CTCAACTTCCTGATCTACAACCAGACAAAAGCCCATGCTTCTCCTAAACTCCGCCATCCT
CGTATCAATAGCCGTGCCCATGCCCGTACCCGTGCACGTTCCCGAGCCTGTGCCCGCCAA
CATCAGGAAGCTTTTGTGTGCCAGATTGTCACCACTGAGGGAAGTGATGGAGAGGAGCGC
CCGTCTTGCTCAGCCCAGCAGCCCCCTAGCCCAGGTAGCCCTGAGGGTCCCCGCAGCCTC
TGCTCCAAGCTGGCCTGCTGTGAGTGGTGCAAGCGTTTTAAGAAGTACTTCTGCATGGTC
CCCGATTGTGAGGGCAGTACCTGGCAGCAGGGCCGCCTCTGCATCCATGTCTACCGCCTG
GATAACTACTCGAGAGTTGTTTTCCCAGTGACTTTCTTCTTCTTCAATGTGCTCTACTGG
CTTGTTTGCCTTAACTTGTAG
Chromosome Location
X
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP78334
UniProtKB Entry NameGBRE_HUMAN
GenBank Protein ID1857126
GenBank Gene IDU66661
HGNC IDHGNC:4085
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00690Flurazepamapproved, illicit, investigationalyespotentiatorDetails
DB00842OxazepamapprovedyespotentiatorDetails
DB00683Midazolamapproved, illicityespotentiatorDetails
DB00231Temazepamapproved, investigationalyespotentiatorDetails
DB01558Bromazepamapproved, illicit, investigationalyespotentiatorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedyespotentiatorDetails
DB01595NitrazepamapprovedyespotentiatorDetails
DB00897Triazolamapproved, investigationalyespotentiatorDetails
DB01559Clotiazepamapproved, illicityespotentiatorDetails
DB01567Fludiazepamexperimental, illicityespotentiatorDetails
DB01588Prazepamapproved, illicityespotentiatorDetails
DB01594CinolazepamexperimentalyespotentiatorDetails
DB01589Quazepamapproved, illicityespotentiatorDetails
DB01215Estazolamapproved, illicityespotentiatorDetails
DB00801Halazepamapproved, illicit, withdrawnyespotentiatorDetails
DB00546AdinazolamexperimentalyespotentiatorDetails
DB01587KetazolamapprovedyespotentiatorDetails
DB00898EthanolapprovedunknownDetails
DB01189Desfluraneapprovedyespositive allosteric modulatorDetails
DB00659Acamprosateapproved, investigationalyespositive modulatorDetails
DB00404Alprazolamapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00237Butabarbitalapproved, illicityespositive allosteric modulatorDetails
DB00475Chlordiazepoxideapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00349Clobazamapproved, illicityespositive allosteric modulatorDetails
DB01068Clonazepamapproved, illicityespositive allosteric modulatorDetails
DB00628Clorazepateapproved, illicityespositive allosteric modulatorDetails
DB00186Lorazepamapprovedyespositive allosteric modulatorDetails
DB00189Ethchlorvynolapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00228Enfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00231Temazepamapproved, investigationalyespositive allosteric modulatorDetails
DB00241Butalbitalapproved, illicityespositive allosteric modulatorDetails
DB00273Topiramateapprovedyespositive allosteric modulatorDetails
DB00292Etomidateapprovedyespositive allosteric modulatorDetails
DB00306Talbutalapproved, illicityespositive allosteric modulatorDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00371Meprobamateapproved, illicityespositive allosteric modulatorDetails
DB00402Eszopicloneapproved, investigationalyespositive allosteric modulatorDetails
DB00463Metharbitalwithdrawnyespositive allosteric modulatorDetails
DB00753Isofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00794Primidoneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00801Halazepamapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00818Propofolapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00842Oxazepamapprovedyespositive allosteric modulatorDetails
DB00897Triazolamapproved, investigationalyespositive allosteric modulatorDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB01107Methyprylonapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB01159Halothaneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01205Flumazenilapprovedyespositive allosteric modulatorDetails
DB01215Estazolamapproved, illicityespositive allosteric modulatorDetails
DB01236Sevofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01437Glutethimideapproved, illicityespositive allosteric modulatorDetails
DB01588Prazepamapproved, illicityespositive allosteric modulatorDetails
DB01589Quazepamapproved, illicityespositive allosteric modulatorDetails
DB00543AmoxapineapprovedunknownbinderDetails
DB00334Olanzapineapproved, investigationalunknowninhibitorDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownantagonistDetails
DB11582ThiocolchicosideexperimentalyesantagonistDetails
DB09118Stiripentolapprovedyesagonistpositive allosteric modulatorDetails
DB01956Taurineapproved, nutraceuticalyesagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11901Apalutamideapproved, investigationalunknownantagonistDetails