Canalicular multispecific organic anion transporter 1

Details

Name
Canalicular multispecific organic anion transporter 1
Synonyms
  • ATP-binding cassette sub-family C member 2
  • Canalicular multidrug resistance protein
  • CMOAT
  • CMOAT1
  • CMRP
  • MRP2
  • Multidrug resistance-associated protein 2
Gene Name
ABCC2
Organism
Human
Amino acid sequence
>lcl|BSEQ0010748|Canalicular multispecific organic anion transporter 1
MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSS
TTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYS
RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILI
FSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVS
KFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSG
TKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIG
YLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGET
VNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAIL
STKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFS
QLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMI
SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD
IMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
FGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIV
EKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAAS
ITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETG
KVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQR
DMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRI
VNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMF
YVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSW
ITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTS
EIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGI
TCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTII
PQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIG
QRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMD
SDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF
Number of residues
1545
Molecular Weight
174205.64
Theoretical pI
8.46
GO Classification
Functions
ATP binding / ATPase activity, coupled to transmembrane movement of substances / organic anion transmembrane transporter activity
Processes
transport / drug transmembrane transport / response to methotrexate / response to heat / response to arsenic-containing substance / response to oxidative stress / cellular chloride ion homeostasis / prostaglandin transport / transmembrane transport / response to estrogen / thyroid hormone transport
Components
plasma membrane / cell surface / integral component of plasma membrane / apical plasma membrane
General Function
Organic anion transmembrane transporter activity
Specific Function
Mediates hepatobiliary excretion of numerous organic anions. May function as a cellular cisplatin transporter.
Pfam Domain Function
Transmembrane Regions
28-48 69-89 94-114 127-147 166-186 314-334 361-381 438-458 462-482 545-565 588-608 972-992 1034-1054 1098-1118 1120-1140 1212-1232 1235-1255
Cellular Location
Apical cell membrane
Gene sequence
>lcl|BSEQ0010749|Canalicular multispecific organic anion transporter 1 (ABCC2)
ATGCTGGAGAAGTTCTGCAACTCTACTTTTTGGAATTCCTCATTCCTGGACAGTCCGGAG
GCAGACCTGCCACTTTGTTTTGAGCAAACTGTTCTGGTGTGGATTCCCTTGGGCTTCCTA
TGGCTCCTGGCCCCCTGGCAGCTTCTCCACGTGTATAAATCCAGGACCAAGAGATCCTCT
ACCACCAAACTCTATCTTGCTAAGCAGGTATTCGTTGGTTTTCTTCTTATTCTAGCAGCC
ATAGAGCTGGCCCTTGTACTCACAGAAGACTCTGGACAAGCCACAGTCCCTGCTGTTCGA
TATACCAATCCAAGCCTCTACCTAGGCACATGGCTCCTGGTTTTGCTGATCCAATACAGC
AGACAATGGTGTGTACAGAAAAACTCCTGGTTCCTGTCCCTATTCTGGATTCTCTCGATA
CTCTGTGGCACTTTCCAATTTCAGACTCTGATCCGGACACTCTTACAGGGTGACAATTCT
AATCTAGCCTACTCCTGCCTGTTCTTCATCTCCTACGGATTCCAGATCCTGATCCTGATC
TTTTCAGCATTTTCAGAAAATAATGAGTCATCAAATAATCCATCATCCATAGCTTCATTC
CTGAGTAGCATTACCTACAGCTGGTATGACAGCATCATTCTGAAAGGCTACAAGCGTCCT
CTGACACTCGAGGATGTCTGGGAAGTTGATGAAGAGATGAAAACCAAGACATTAGTGAGC
AAGTTTGAAACGCACATGAAGAGAGAGCTGCAGAAAGCCAGGCGGGCACTCCAGAGACGG
CAGGAGAAGAGCTCCCAGCAGAACTCTGGAGCCAGGCTGCCTGGCTTGAACAAGAATCAG
AGTCAAAGCCAAGATGCCCTTGTCCTGGAAGATGTTGAAAAGAAAAAAAAGAAGTCTGGG
ACCAAAAAAGATGTTCCAAAATCCTGGTTGATGAAGGCTCTGTTCAAAACTTTCTACATG
GTGCTCCTGAAATCATTCCTACTGAAGCTAGTGAATGACATCTTCACGTTTGTGAGTCCT
CAGCTGCTGAAATTGCTGATCTCCTTTGCAAGTGACCGTGACACATATTTGTGGATTGGA
TATCTCTGTGCAATCCTCTTATTCACTGCGGCTCTCATTCAGTCTTTCTGCCTTCAGTGT
TATTTCCAACTGTGCTTCAAGCTGGGTGTAAAAGTACGGACAGCTATCATGGCTTCTGTA
TATAAGAAGGCATTGACCCTATCCAACTTGGCCAGGAAGGAGTACACCGTTGGAGAAACA
GTGAACCTGATGTCTGTGGATGCCCAGAAGCTCATGGATGTGACCAACTTCATGCACATG
CTGTGGTCAAGTGTTCTACAGATTGTCTTATCTATCTTCTTCCTATGGAGAGAGTTGGGA
CCCTCAGTCTTAGCAGGTGTTGGGGTGATGGTGCTTGTAATCCCAATTAATGCGATACTG
TCCACCAAGAGTAAGACCATTCAGGTCAAAAATATGAAGAATAAAGACAAACGTTTAAAG
ATCATGAATGAGATTCTTAGTGGAATCAAGATCCTGAAATATTTTGCCTGGGAACCTTCA
TTCAGAGACCAAGTACAAAACCTCCGGAAGAAAGAGCTCAAGAACCTGCTGGCCTTTAGT
CAACTACAGTGTGTAGTAATATTCGTCTTCCAGTTAACTCCAGTCCTGGTATCTGTGGTC
ACATTTTCTGTTTATGTCCTGGTGGATAGCAACAATATTTTGGATGCACAAAAGGCCTTC
ACCTCCATTACCCTCTTCAATATCCTGCGCTTTCCCCTGAGCATGCTTCCCATGATGATC
TCCTCCATGCTCCAGGCCAGTGTTTCCACAGAGCGGCTAGAGAAGTACTTGGGAGGGGAT
GACTTGGACACATCTGCCATTCGACATGACTGCAATTTTGACAAAGCCATGCAGTTTTCT
GAGGCCTCCTTTACCTGGGAACATGATTCGGAAGCCACAGTCCGAGATGTGAACCTGGAC
ATTATGGCAGGCCAACTTGTGGCTGTGATAGGCCCTGTCGGCTCTGGGAAATCCTCCTTG
ATATCAGCCATGCTGGGAGAAATGGAAAATGTCCACGGGCACATCACCATCAAGGGCACC
ACTGCCTATGTCCCACAGCAGTCCTGGATTCAGAATGGCACCATAAAGGACAACATCCTT
TTTGGAACAGAGTTTAATGAAAAGAGGTACCAGCAAGTACTGGAGGCCTGTGCTCTCCTC
CCAGACTTGGAAATGCTGCCTGGAGGAGATTTGGCTGAGATTGGAGAGAAGGGTATAAAT
CTTAGTGGGGGTCAGAAGCAGCGGATCAGCCTGGCCAGAGCTACCTACCAAAATTTAGAC
ATCTATCTTCTAGATGACCCCCTGTCTGCAGTGGATGCTCATGTAGGAAAACATATTTTT
AATAAGGTCTTGGGCCCCAATGGCCTGTTGAAAGGCAAGACTCGACTCTTGGTTACACAT
AGCATGCACTTTCTTCCTCAAGTGGATGAGATTGTAGTTCTGGGGAATGGAACAATTGTA
GAGAAAGGATCCTACAGTGCTCTCCTGGCCAAAAAAGGAGAGTTTGCTAAGAATCTGAAG
ACATTTCTAAGACATACAGGCCCTGAAGAGGAAGCCACAGTCCATGATGGCAGTGAAGAA
GAAGACGATGACTATGGGCTGATATCCAGTGTGGAAGAGATCCCCGAAGATGCAGCCTCC
ATAACCATGAGAAGAGAGAACAGCTTTCGTCGAACACTTAGCCGCAGTTCTAGGTCCAAT
GGCAGGCATCTGAAGTCCCTGAGAAACTCCTTGAAAACTCGGAATGTGAATAGCCTGAAG
GAAGACGAAGAACTAGTGAAAGGACAAAAACTAATTAAGAAGGAATTCATAGAAACTGGA
AAGGTGAAGTTCTCCATCTACCTGGAGTACCTACAAGCAATAGGATTGTTTTCGATATTC
TTCATCATCCTTGCGTTTGTGATGAATTCTGTGGCTTTTATTGGATCCAACCTCTGGCTC
AGTGCTTGGACCAGTGACTCTAAAATCTTCAATAGCACCGACTATCCAGCATCTCAGAGG
GACATGAGAGTTGGAGTCTACGGAGCTCTGGGATTAGCCCAAGGTATATTTGTGTTCATA
GCACATTTCTGGAGTGCCTTTGGTTTCGTCCATGCATCAAATATCTTGCACAAGCAACTG
CTGAACAATATCCTTCGAGCACCTATGAGATTTTTTGACACAACACCCACAGGCCGGATT
GTGAACAGGTTTGCCGGCGATATTTCCACAGTGGATGACACCCTGCCTCAGTCCTTGCGC
AGCTGGATTACATGCTTCCTGGGGATAATCAGCACCCTTGTCATGATCTGCATGGCCACT
CCTGTCTTCACCATCATCGTCATTCCTCTTGGCATTATTTATGTATCTGTTCAGATGTTT
TATGTGTCTACCTCCCGCCAGCTGAGGCGTCTGGACTCTGTCACCAGGTCCCCAATCTAC
TCTCACTTCAGCGAGACCGTATCAGGTTTGCCAGTTATCCGTGCCTTTGAGCACCAGCAG
CGATTTCTGAAACACAATGAGGTGAGGATTGACACCAACCAGAAATGTGTCTTTTCCTGG
ATCACCTCCAACAGGTGGCTTGCAATTCGCCTGGAGCTGGTTGGGAACCTGACTGTCTTC
TTTTCAGCCTTGATGATGGTTATTTATAGAGATACCCTAAGTGGGGACACTGTTGGCTTT
GTTCTGTCCAATGCACTCAATATCACACAAACCCTGAACTGGCTGGTGAGGATGACATCA
GAAATAGAGACCAACATTGTGGCTGTTGAGCGAATAACTGAGTACACAAAAGTGGAAAAT
GAGGCACCCTGGGTGACTGATAAGAGGCCTCCGCCAGATTGGCCCAGCAAAGGCAAGATC
CAGTTTAACAACTACCAAGTGCGGTACCGACCTGAGCTGGATCTGGTCCTCAGAGGGATC
ACTTGTGACATCGGTAGCATGGAGAAGATTGGTGTGGTGGGCAGGACAGGAGCTGGAAAG
TCATCCCTCACAAACTGCCTCTTCAGAATCTTAGAGGCTGCCGGTGGTCAGATTATCATT
GATGGAGTAGATATTGCTTCCATTGGGCTCCACGACCTCCGAGAGAAGCTGACCATCATC
CCCCAGGACCCCATCCTGTTCTCTGGAAGCCTGAGGATGAATCTCGACCCTTTCAACAAC
TACTCAGATGAGGAGATTTGGAAGGCCTTGGAGCTGGCTCACCTCAAGTCTTTTGTGGCC
AGCCTGCAACTTGGGTTATCCCACGAAGTGACAGAGGCTGGTGGCAACCTGAGCATAGGC
CAGAGGCAGCTGCTGTGCCTGGGCAGGGCTCTGCTTCGGAAATCCAAGATCCTGGTCCTG
GATGAGGCCACTGCTGCGGTGGATCTAGAGACAGACAACCTCATTCAGACGACCATCCAA
AACGAGTTCGCCCACTGCACAGTGATCACCATCGCCCACAGGCTGCACACCATCATGGAC
AGTGACAAGGTAATGGTCCTAGACAACGGGAAGATTATAGAGTGCGGCAGCCCTGAAGAA
CTGCTACAAATCCCTGGACCCTTTTACTTTATGGCTAAGGAAGCTGGCATTGAGAATGTG
AACAGCACAAAATTCTAG
Chromosome Location
10
Locus
10q24
External Identifiers
ResourceLink
UniProtKB IDQ92887
UniProtKB Entry NameMRP2_HUMAN
GenBank Protein ID1764162
GenBank Gene IDU63970
GenAtlas IDABCC2
HGNC IDHGNC:53
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00171ATPinvestigational, nutraceuticalunknownDetails
DB01138SulfinpyrazoneapprovedyesinhibitorDetails
DB00503Ritonavirapproved, investigationalunknownsubstrateinducerDetails
DB01892HyperforinnutraceuticalunknowninducerDetails
DB01586Ursodeoxycholic acidapproved, investigationalunknowninducerDetails
DB01045RifampicinapprovedunknowninducerDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninducerDetails
DB01169Arsenic trioxideapproved, investigationalunknowninducerDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB00515CisplatinapprovedunknowninducerDetails
DB04216Quercetinexperimental, investigationalunknowninducerDetails
DB04348Taurocholic AcidexperimentalunknowninducerDetails
DB02659Cholic AcidapprovedunknowninducerDetails
DB01115NifedipineapprovedunknowninducerDetails
DB00977EthinylestradiolapprovedunknowninducerDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB00570VinblastineapprovedunknownsubstrateinhibitorinducerDetails
DB00421SpironolactoneapprovedunknowninducerDetails
DB00876EprosartanapprovedunknowninducerDetails
DB00275Olmesartanapproved, investigationalunknownsubstrateinducerDetails
DB01138SulfinpyrazoneapprovedunknownsubstrateinhibitorDetails
DB00541Vincristineapproved, investigationalunknownsubstrateinhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00206Reserpineapproved, investigationalunknowninhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB00773EtoposideapprovedunknownsubstrateinhibitorDetails
DB00694DaunorubicinapprovedunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknownsubstrateinhibitorDetails
DB00143Glutathioneapproved, investigational, nutraceuticalunknownsubstrateinhibitorDetails
DB00695Furosemideapproved, vet_approvedunknowninhibitorDetails
DB00175PravastatinapprovedunknownsubstrateinhibitorDetails
DB00602Ivermectinapproved, investigational, vet_approvedunknowninhibitorDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB00328Indomethacinapproved, investigationalunknownsubstrateinhibitorDetails
DB00563MethotrexateapprovedunknownsubstrateinhibitorDetails
DB02703Fusidic Acidapproved, investigationalunknowninhibitorDetails
DB01208Sparfloxacinapproved, investigational, withdrawnunknowninhibitorDetails
DB00978Lomefloxacinapproved, investigationalunknowninhibitorDetails
DB00365Grepafloxacinapproved, investigational, withdrawnunknowninhibitorDetails
DB01165OfloxacinapprovedunknowninhibitorDetails
DB00116Tetrahydrofolic acidnutraceuticalunknowninhibitorDetails
DB047895-methyltetrahydrofolic acidinvestigational, nutraceuticalunknowninhibitorDetails
DB04100(1,10 Phenanthroline)-(Tri-Carbon Monoxide) Rhenium (I)experimentalunknowninhibitorDetails
DB01411PranlukastinvestigationalunknowninhibitorDetails
DB00398Sorafenibapproved, investigationalunknowninhibitorDetails
DB01268Sunitinibapproved, investigationalunknowninhibitorDetails
DB00966Telmisartanapproved, investigationalunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknownsubstrateinhibitorDetails
DB01232Saquinavirapproved, investigationalunknownsubstrateDetails
DB00224IndinavirapprovedunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateDetails
DB01202Levetiracetamapproved, investigationalunknownsubstrateDetails
DB00252Phenytoinapproved, vet_approvedunknownsubstrateDetails
DB00067VasopressinapprovedunknownsubstrateDetails
DB00795SulfasalazineapprovedunknownsubstrateDetails
DB00957Norgestimateapproved, investigationalunknownsubstrateDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB08884Gadoxetic acidapprovedunknownsubstrateDetails
DB08907CanagliflozinapprovedunknownsubstrateDetails
DB01076AtorvastatinapprovedunknownsubstrateDetails
DB00227Lovastatinapproved, investigationalunknownsubstrateDetails
DB00641SimvastatinapprovedunknownsubstrateDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateDetails
DB00997Doxorubicinapproved, investigationalunknownsubstrateDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB00709Lamivudineapproved, investigationalunknownDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB00958CarboplatinapprovedunknownsubstrateDetails
DB00526Oxaliplatinapproved, investigationalunknownsubstrateDetails
DB00675TamoxifenapprovedunknownsubstrateDetails
DB00300Tenofovir disoproxilapproved, investigationalunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB09272Eluxadolineapproved, investigationalunknownsubstrateDetails
DB09060AvibactamapprovednosubstrateDetails
DB09374Indocyanine green acid formapproved, investigationalyestransporterDetails
DB06290SimeprevirapprovedunknownsubstrateinhibitorDetails
DB01095FluvastatinapprovednosubstrateDetails
DB01098RosuvastatinapprovednosubstrateDetails
DB12070Letermovirapproved, investigationalnoinhibitorDetails
DB14642LypressinapprovedunknownDetails