Solute carrier family 22 member 6

Details

Name
Solute carrier family 22 member 6
Synonyms
  • hOAT1
  • hPAHT
  • hROAT1
  • OAT1
  • Organic anion transporter 1
  • PAH transporter
  • PAHT
  • Renal organic anion transporter 1
Gene Name
SLC22A6
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037120|Solute carrier family 22 member 6
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI
VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE
GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS
IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE
LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT
RQQQEHQKYMVPLQASAQEKNGL
Number of residues
563
Molecular Weight
61815.78
Theoretical pI
8.78
GO Classification
Functions
chloride ion binding / inorganic anion exchanger activity / organic anion transmembrane transporter activity / sodium-independent organic anion transmembrane transporter activity
Processes
alpha-ketoglutarate transport / anion transmembrane transport / organic anion transport / protein homooligomerization / renal tubular secretion / response to methotrexate / sodium-independent organic anion transport / transmembrane transport
Components
basolateral plasma membrane / caveola / extracellular exosome / integral component of plasma membrane / plasma membrane / protein complex
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of 2,3-dimercapto-1-propanesulfonic acid (DMPS) (By similarity). Mediates the sodium-independent uptake of p-aminohippurate (PAH), ochratoxin (OTA), acyclovir (ACV), 3'-azido-3-'deoxythymidine (AZT), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), hippurate (HA), indoleacetate (IA), indoxyl sulfate (IS) and 3-carboxy-4-methyl-5-propyl-2-furanpropionate (CMPF), cidofovir, adefovir, 9-(2-phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP) and edaravone sulfate. PAH uptake is inhibited by p-chloromercuribenzenesulphonate (PCMBS), diethyl pyrocarbonate (DEPC), sulindac, diclofenac, carprofen, glutarate and okadaic acid (By similarity). PAH uptake is inhibited by benzothiazolylcysteine (BTC), S-chlorotrifluoroethylcysteine (CTFC), cysteine S-conjugates S-dichlorovinylcysteine (DCVC), furosemide, steviol, phorbol 12-myristate 13-acetate (PMA), calcium ionophore A23187, benzylpenicillin, furosemide, indomethacin, bumetamide, losartan, probenecid, phenol red, urate, and alpha-ketoglutarate.
Pfam Domain Function
Transmembrane Regions
10-30 136-156 165-187 191-213 225-245 249-269 338-358 369-389 396-416 426-446 456-475 485-505
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010747|Solute carrier family 22 member 6 (SLC22A6)
ATGGCCTTTAATGACCTCCTGCAGCAGGTGGGGGGTGTCGGCCGCTTCCAGCAGATCCAG
GTCACCCTGGTGGTCCTCCCCCTGCTCCTGATGGCTTCTCACAACACCCTGCAGAACTTC
ACTGCTGCCATCCCTACCCACCACTGCCGCCCGCCTGCCGATGCCAACCTCAGCAAGAAC
GGGGGGCTGGAGGTCTGGCTGCCCCGGGACAGGCAGGGGCAGCCTGAGTCCTGCCTCCGC
TTCACCTCCCCGCAGTGGGGACTGCCCTTTCTCAATGGCACAGAAGCCAATGGCACAGGG
GCCACAGAGCCCTGCACCGATGGCTGGATCTATGACAACAGCACCTTCCCATCTACCATC
GTGACTGAGTGGGACCTTGTGTGCTCTCACAGGGCCCTACGCCAGCTGGCCCAGTCCTTG
TACATGGTGGGGGTGCTGCTCGGAGCCATGGTGTTCGGCTACCTTGCAGACAGGCTAGGC
CGCCGGAAGGTACTCATCTTGAACTACCTGCAGACAGCTGTGTCAGGGACCTGCGCAGCC
TTCGCACCCAACTTCCCCATCTACTGCGCCTTCCGGCTCCTCTCGGGCATGGCTCTGGCT
GGCATCTCCCTCAACTGCATGACACTGAATGTGGAGTGGATGCCCATTCACACACGGGCC
TGCGTGGGCACCTTGATTGGCTATGTCTACAGCCTGGGCCAGTTCCTCCTGGCTGGTGTG
GCCTACGCTGTGCCCCACTGGCGCCACCTGCAGCTACTGGTCTCTGCGCCTTTTTTTGCC
TTCTTCATCTACTCCTGGTTCTTCATTGAGTCGGCCCGCTGGCACTCCTCCTCCGGGAGG
CTGGACCTCACCCTGAGGGCCCTGCAGAGAGTCGCCCGGATCAATGGGAAGCGGGAAGAA
GGAGCCAAATTGAGTATGGAGGTACTCCGGGCCAGTCTGCAGAAGGAGCTGACCATGGGC
AAAGGCCAGGCATCGGCCATGGAGCTGCTGCGCTGCCCCACCCTCCGCCACCTCTTCCTC
TGCCTCTCCATGCTGTGGTTTGCCACTAGCTTTGCATACTATGGGCTGGTCATGGACCTG
CAGGGCTTTGGAGTCAGCATCTACCTAATCCAGGTGATCTTTGGTGCTGTGGACCTGCCT
GCCAAGCTTGTGGGCTTCCTTGTCATCAACTCCCTGGGTCGCCGGCCTGCCCAGATGGCT
GCACTGCTGCTGGCAGGCATCTGCATCCTGCTCAATGGGGTGATACCCCAGGACCAGTCC
ATTGTCCGAACCTCTCTTGCTGTGCTGGGGAAGGGTTGTCTGGCTGCCTCCTTCAACTGC
ATCTTCCTGTATACTGGGGAACTGTATCCCACAATGATCCGGCAGACAGGCATGGGAATG
GGCAGCACCATGGCCCGAGTGGGCAGCATCGTGAGCCCACTGGTGAGCATGACTGCCGAG
CTCTACCCCTCCATGCCTCTCTTCATCTACGGTGCTGTTCCTGTGGCCGCCAGCGCTGTC
ACTGTCCTCCTGCCAGAGACCCTGGGCCAGCCACTGCCAGACACGGTGCAGGACCTGGAG
AGCAGGTGGGCCCCCACTCAGAAAGAAGCAGGGATATATCCCAGGAAAGGGAAACAGACG
CGACAGCAACAAGAGCACCAGAAGTATATGGTCCCACTGCAGGCCTCAGCACAAGAGAAG
AATGGACTCTGA
Chromosome Location
11
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ4U2R8
UniProtKB Entry NameS22A6_HUMAN
GenBank Protein ID3831566
GenBank Gene IDAF057039
GenAtlas IDhROAT1
HGNC IDHGNC:10970
General References
  1. Reid G, Wolff NA, Dautzenberg FM, Burckhardt G: Cloning of a human renal p-aminohippurate transporter, hROAT1. Kidney Blood Press Res. 1998;21(2-4):233-7. [PubMed:9762842]
  2. Hosoyamada M, Sekine T, Kanai Y, Endou H: Molecular cloning and functional expression of a multispecific organic anion transporter from human kidney. Am J Physiol. 1999 Jan;276(1 Pt 2):F122-8. [PubMed:9887087]
  3. Lu R, Chan BS, Schuster VL: Cloning of the human kidney PAH transporter: narrow substrate specificity and regulation by protein kinase C. Am J Physiol. 1999 Feb;276(2 Pt 2):F295-303. [PubMed:9950961]
  4. Race JE, Grassl SM, Williams WJ, Holtzman EJ: Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3). Biochem Biophys Res Commun. 1999 Feb 16;255(2):508-14. [PubMed:10049739]
  5. Cihlar T, Lin DC, Pritchard JB, Fuller MD, Mendel DB, Sweet DH: The antiviral nucleotide analogs cidofovir and adefovir are novel substrates for human and rat renal organic anion transporter 1. Mol Pharmacol. 1999 Sep;56(3):570-80. [PubMed:10462545]
  6. Bahn A, Prawitt D, Buttler D, Reid G, Enklaar T, Wolff NA, Ebbinghaus C, Hillemann A, Schulten HJ, Gunawan B, Fuzesi L, Zabel B, Burckhardt G: Genomic structure and in vivo expression of the human organic anion transporter 1 (hOAT1) gene. Biochem Biophys Res Commun. 2000 Aug 28;275(2):623-30. [PubMed:10964714]
  7. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  9. Groves CE, Munoz L, Bahn A, Burckhardt G, Wright SH: Interaction of cysteine conjugates with human and rabbit organic anion transporter 1. J Pharmacol Exp Ther. 2003 Feb;304(2):560-6. [PubMed:12538807]
  10. Tanaka K, Xu W, Zhou F, You G: Role of glycosylation in the organic anion transporter OAT1. J Biol Chem. 2004 Apr 9;279(15):14961-6. Epub 2004 Jan 28. [PubMed:14749323]
  11. Hong M, Zhou F, You G: Critical amino acid residues in transmembrane domain 1 of the human organic anion transporter hOAT1. J Biol Chem. 2004 Jul 23;279(30):31478-82. Epub 2004 May 15. [PubMed:15145940]
  12. Srimaroeng C, Chatsudthipong V, Aslamkhan AG, Pritchard JB: Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8). J Pharmacol Exp Ther. 2005 May;313(2):621-8. Epub 2005 Jan 11. [PubMed:15644426]
  13. Tahara H, Shono M, Kusuhara H, Kinoshita H, Fuse E, Takadate A, Otagiri M, Sugiyama Y: Molecular cloning and functional analyses of OAT1 and OAT3 from cynomolgus monkey kidney. Pharm Res. 2005 Apr;22(4):647-60. Epub 2005 Apr 7. [PubMed:15846473]
  14. Perry JL, Dembla-Rajpal N, Hall LA, Pritchard JB: A three-dimensional model of human organic anion transporter 1: aromatic amino acids required for substrate transport. J Biol Chem. 2006 Dec 8;281(49):38071-9. Epub 2006 Oct 11. [PubMed:17038320]
  15. Mizuno N, Takahashi T, Iwase Y, Kusuhara H, Niwa T, Sugiyama Y: Human organic anion transporters 1 (hOAT1/SLC22A6) and 3 (hOAT3/SLC22A8) transport edaravone (MCI-186; 3-methyl-1-phenyl-2-pyrazolin-5-one) and its sulfate conjugate. Drug Metab Dispos. 2007 Aug;35(8):1429-34. Epub 2007 May 14. [PubMed:17502342]
  16. Bleasby K, Hall LA, Perry JL, Mohrenweiser HW, Pritchard JB: Functional consequences of single nucleotide polymorphisms in the human organic anion transporter hOAT1 (SLC22A6). J Pharmacol Exp Ther. 2005 Aug;314(2):923-31. Epub 2005 May 24. [PubMed:15914676]
  17. Xu G, Bhatnagar V, Wen G, Hamilton BA, Eraly SA, Nigam SK: Analyses of coding region polymorphisms in apical and basolateral human organic anion transporter (OAT) genes [OAT1 (NKT), OAT2, OAT3, OAT4, URAT (RST)]. Kidney Int. 2005 Oct;68(4):1491-9. [PubMed:16164626]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00695Furosemideapproved, vet_approvedunknowninhibitorinducerDetails
DB00936Salicylic acidapproved, investigational, vet_approvedunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknownsubstrateinhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknownsubstrateinhibitorDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB03553Glutaric AcidexperimentalunknownsubstrateinhibitorDetails
DB00369CidofovirapprovedunknownsubstrateinhibitorDetails
DB01333CefradineapprovedunknowninhibitorDetails
DB00718Adefovir Dipivoxilapproved, investigationalunknownsubstrateinhibitorDetails
DB00554Piroxicamapproved, investigationalunknowninhibitorDetails
DB03783PhenacetinwithdrawnunknowninhibitorDetails
DB00788Naproxenapproved, vet_approvedunknowninhibitorDetails
DB00328Indometacinapproved, investigationalunknownsubstrateinhibitorDetails
DB01050IbuprofenapprovedunknowninhibitorDetails
DB00712Flurbiprofenapproved, investigationalunknowninhibitorDetails
DB00749Etodolacapproved, investigational, vet_approvedunknowninhibitorDetails
DB00861Diflunisalapproved, investigationalunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB01597Cilastatinapproved, investigationalunknowninhibitorDetails
DB01053Benzylpenicillinapproved, vet_approvedunknowninhibitorDetails
DB04519Caprylic acidinvestigationalunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknownsubstrateinhibitorDetails
DB00168Aspartameinvestigational, nutraceuticalunknowninhibitorDetails
DB00759Tetracyclineapproved, vet_approvedunknowninhibitorDetails
DB00595Oxytetracyclineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01017Minocyclineapproved, investigationalunknowninhibitorDetails
DB00254Doxycyclineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01004Ganciclovirapproved, investigationalunknowninhibitorDetails
DB00787AcyclovirapprovedunknownsubstrateinhibitorDetails
DB00917DinoprostoneapprovedunknownsubstrateinhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedunknowninhibitorDetails
DB01212CeftriaxoneapprovedunknowninhibitorDetails
DB00493CefotaximeapprovedunknowninhibitorDetails
DB01329Cefoperazoneapproved, investigationalunknowninhibitorDetails
DB01327CefazolinapprovedunknownsubstrateinhibitorDetails
DB01326Cefamandoleapproved, experimentalunknowninhibitorDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnunknowninhibitorDetails
DB00812Phenylbutazoneapproved, vet_approvedunknowninhibitorDetails
DB00563MethotrexateapprovedunknownsubstrateinhibitorDetails
DB00693FluoresceinapprovedunknownsubstrateinhibitorDetails
DB00678LosartanapprovedunknowninhibitorDetails
DB00999Hydrochlorothiazideapproved, vet_approvedunknowninhibitorDetails
DB00887BumetanideapprovedunknownsubstrateinhibitorDetails
DB00175PravastatinapprovedunknowninhibitorDetails
DB00520CaspofunginapprovedunknowninhibitorDetails
DB00605Sulindacapproved, investigationalunknowninhibitorDetails
DB00140Riboflavinapproved, investigational, nutraceutical, vet_approvedunknowninhibitorDetails
DB00158Folic Acidapproved, nutraceutical, vet_approvedunknowninhibitorDetails
DB00584Enalaprilapproved, vet_approvedunknowninhibitorDetails
DB00821Carprofenapproved, vet_approved, withdrawnunknowninhibitorDetails
DB01197CaptoprilapprovedunknownsubstrateinhibitorDetails
DB01124Tolbutamideapproved, investigationalunknowninhibitorDetails
DB01060Amoxicillinapproved, vet_approvedunknowninhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00313Valproic Acidapproved, investigationalunknowninhibitorDetails
DB00798Gentamicinapproved, vet_approvedunknowninhibitorDetails
DB00779Nalidixic acidapproved, investigationalunknowninhibitorDetails
DB00903Etacrynic acidapproved, investigationalunknowninhibitorDetails
DB00091Ciclosporinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00703MethazolamideapprovedunknowninhibitorDetails
DB00311EthoxzolamidewithdrawnunknowninhibitorDetails
DB00606CyclothiazideapprovedunknowninhibitorDetails
DB00880Chlorothiazideapproved, vet_approvedunknowninhibitorDetails
DB00819Acetazolamideapproved, vet_approvedunknowninhibitorDetails
DB02266Flufenamic AcidapprovedunknowninhibitorDetails
DB00500TolmetinapprovedunknowninhibitorDetails
DB00945Acetylsalicylic acidapproved, vet_approvedunknowninhibitorDetails
DB01435Antipyrineapproved, investigationalunknowninhibitorDetails
DB00316AcetaminophenapprovedunknowninhibitorDetails
DB03585Oxyphenbutazoneapproved, withdrawnunknowninhibitorDetails
DB00939Meclofenamic acidapproved, vet_approvedunknowninhibitorDetails
DB01424Aminophenazoneapproved, withdrawnunknowninhibitorDetails
DB00731Nateglinideapproved, investigationalunknowninhibitorDetails
DB01082Streptomycinapproved, vet_approvedunknowninhibitorDetails
DB00319PiperacillinapprovedunknowninhibitorDetails
DB01165OfloxacinapprovedunknowninhibitorDetails
DB01059NorfloxacinapprovedunknowninhibitorDetails
DB00607Nafcillinapproved, investigationalunknowninhibitorDetails
DB01147Cloxacillinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00827Cinoxacinapproved, investigational, withdrawnunknowninhibitorDetails
DB00446Chloramphenicolapproved, vet_approvedunknowninhibitorDetails
DB00438CeftazidimeapprovedunknowninhibitorDetails
DB00578Carbenicillinapproved, investigationalunknowninhibitorDetails
DB00432Trifluridineapproved, investigationalunknownsubstrateinhibitorDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateinhibitorDetails
DB00529FoscarnetapprovedunknowninhibitorDetails
DB00672Chlorpropamideapproved, investigationalunknowninhibitorDetails
DB00229Cefotiamapproved, investigationalunknownsubstrateinhibitorDetails
DB01051Novobiocinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB02527Cyclic Adenosine MonophosphateexperimentalunknownsubstrateDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB01137Levofloxacinapproved, investigationalunknownsubstrateDetails
DB00365Grepafloxacinapproved, investigational, withdrawnunknownsubstrateDetails
DB00649Stavudineapproved, investigationalunknownsubstrateDetails
DB00943Zalcitabineapproved, investigationalunknownsubstrateDetails
DB00900DidanosineapprovedunknownsubstrateDetails
DB01032Probenecidapproved, investigationalyesinhibitorDetails
DB01237BromodiphenhydramineapprovedunknownDetails
DB01414CefacetrileexperimentalunknownsubstrateinhibitorDetails
DB00577Valaciclovirapproved, investigationalunknownDetails
DB08843GS 0573investigationalunknownDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB02315Cyclic Guanosine MonophosphateexperimentalunknownDetails
DB08844Uric Acidexperimental, investigationalunknownDetails
DB01160Dinoprost Tromethamineapproved, vet_approvedunknownDetails
DB06151Acetylcysteineapproved, investigationalunknownDetails
DB08846Ellagic AcidinvestigationalunknownsubstrateinhibitorDetails
DB04133Degraded CephaloridineexperimentalunknownDetails
DB08912Dabrafenibapproved, investigationalunknowninhibitorDetails
DB00300Tenofovir disoproxilapproved, investigationalunknownsubstrateDetails
DB00493CefotaximeapprovedunknownDetails
DB01212CeftriaxoneapprovedunknownDetails
DB01685TopiroxostatexperimentalunknowninhibitorDetails
DB05016Atalurenapproved, investigationalnoinhibitorDetails
DB13874Enasidenibapproved, investigationalunknowninhibitorDetails
DB08930DolutegravirapprovednoinhibitorDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB11817Baricitinibapproved, investigationalunknowninhibitorDetails
DB00535CefdinirapprovedunknownsubstrateDetails
DB01415Ceftibutenapproved, investigationalunknownsubstrateDetails
DB01332Ceftizoximeapproved, investigationalunknownsubstrateDetails
DB09008Cefaloridineexperimental, withdrawnunknownsubstrateDetails
DB00155L-Citrullineapproved, investigational, nutraceuticalunknownsubstrateDetails
DB12243Edaravoneapproved, investigationalunknownsubstrateDetails
DB00770Alprostadilapproved, investigationalunknownsubstrateinhibitorDetails
DB00863RanitidineapprovedunknownsubstrateinhibitorDetails
DB09298Silibinin Aexperimental, investigationalunknownsubstrateinhibitorDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB01606TazobactamapprovedunknownsubstrateDetails
DB01045RifampicinapprovedunknowninhibitorDetails
DB11751CabotegravirinvestigationalunknowninhibitorDetails
DB09213Dexibuprofenapproved, investigationalunknownDetails