Solute carrier organic anion transporter family member 1A2

Details

Name
Solute carrier organic anion transporter family member 1A2
Synonyms
  • OATP
  • OATP-1
  • OATP-A
  • OATP1
  • OATP1A2
  • Organic anion-transporting polypeptide 1
  • SLC21A3
  • Sodium-independent organic anion transporter
  • Solute carrier family 21 member 3
Gene Name
SLCO1A2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007000|Solute carrier organic anion transporter family member 1A2
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL
Number of residues
670
Molecular Weight
74144.105
Theoretical pI
5.75
GO Classification
Functions
bile acid transmembrane transporter activity / organic anion transmembrane transporter activity / sodium-independent organic anion transmembrane transporter activity
Processes
anion transmembrane transport / bile acid and bile salt transport / bile acid metabolic process / mitophagy in response to mitochondrial depolarization / organic anion transport / small molecule metabolic process / sodium-independent organic anion transport / transmembrane transport
Components
integral component of plasma membrane / plasma membrane
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids (By similarity). Selectively inhibited by the grapefruit juice component naringin.
Pfam Domain Function
Transmembrane Regions
21-40 60-80 87-111 156-184 204-224 243-267 312-333 354-377 382-405 514-536 546-571 606-623
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0012532|Solute carrier organic anion transporter family member 1A2 (SLCO1A2)
ATGGGAGAAACTGAGAAAAGAATTGAAACCCATAGAATAAGATGTCTTTCCAAGTTGAAG
ATGTTTCTGTTGGCAATAACATGTGCATTTGTATCCAAAACACTGTCTGGATCTTATATG
AATTCCATGCTCACACAAATAGAGAGACAATTCAACATCCCAACATCTCTAGTTGGATTC
ATTAATGGAAGCTTTGAGATTGGAAATCTTTTGTTGATTATATTTGTGAGTTATTTTGGA
ACCAAACTGCATAGACCTATAATGATTGGCATTGGATGTGTGGTTATGGGCTTAGGCTGT
TTCTTAAAATCACTACCTCATTTCCTCATGAACCAATATGAATATGAATCTACAGTTTCA
GTTTCAGGCAACTTGTCCTCAAACAGTTTCTTGTGTATGGAAAATGGAACCCAGATTTTA
AGACCAACGCAGGATCCATCAGAGTGTACAAAGGAAGTTAAATCATTAATGTGGGTGTAC
GTCCTAGTAGGCAATATTGTACGTGGAATGGGTGAAACTCCCATCCTGCCTTTGGGTATT
TCCTATATAGAAGATTTTGCCAAATTTGAAAATTCTCCTTTATATATTGGGCTTGTAGAA
ACAGGAGCTATTATTGGTCCTTTGATTGGACTTTTGTTGGCATCATTCTGTGCAAATGTT
TATGTTGACACTGGATTTGTGAACACAGATGATCTGATCATAACTCCCACTGACACTCGT
TGGGTCGGTGCATGGTGGTTTGGCTTTCTGATTTGTGCAGGAGTTAACGTGCTCACTGCC
ATTCCTTTTTTCTTTTTGCCCAACACACTTCCAAAGGAAGGACTAGAGACTAATGCTGAC
ATCATTAAAAATGAAAATGAAGACAAACAAAAAGAAGAGGTCAAGAAGGAAAAATATGGA
ATCACTAAAGATTTTCTACCTTTCATGAAAAGTCTTTCCTGCAATCCAATTTATATGCTT
TTCATACTTGTAAGTGTGATACAGTTCAATGCATTCGTTAACATGATCTCCTTCATGCCT
AAATACCTAGAACAGCAATATGGAATATCATCTTCAGATGCAATCTTTCTAATGGGTATT
TATAACTTACCTCCAATATGTATTGGATATATAATTGGTGGTTTAATTATGAAGAAGTTC
AAGATTACTGTCAAACAAGCTGCCCACATAGGATGTTGGTTATCCTTACTTGAGTATCTT
CTCTATTTTTTATCTTTTCTCATGACTTGTGAAAATTCTTCAGTTGTTGGAATAAATACC
TCTTATGAAGGAATTCCACAAGATTTATATGTGGAAAATGACATCTTTGCTGATTGCAAT
GTGGATTGCAACTGTCCATCTAAAATATGGGATCCTGTGTGTGGAAACAATGGCTTGTCA
TATCTGTCAGCTTGTCTTGCTGGTTGTGAGACATCCATTGGAACGGGAATAAACATGGTG
TTCCAAAATTGCAGCTGTATTCAAACATCAGGAAATTCATCTGCAGTTCTTGGGCTGTGC
GACAAAGGACCTGACTGTTCCTTGATGCTCCAGTACTTCCTAATCTTGTCAGCGATGAGC
AGTTTCATTTATTCTTTGGCTGCCATACCTGGATATATGGTTCTCTTGAGGTGTATGAAA
TCTGAAGAGAAGTCCCTTGGTGTGGGATTACATACATTTTGCACAAGAGTATTTGCTGGC
ATTCCTGCACCTATATATTTTGGCGCTTTAATGGATTCCACATGTTTACACTGGGGAACT
TTGAAATGTGGTGAGTCAGGGGCATGCAGGATATATGATTCCACCACCTTCAGATACATC
TACCTCGGATTGCCGGCAGCACTAAGAGGATCAAGCTTTGTTCCAGCCTTAATCATCTTA
ATTCTTTTGAGGAAGTGTCATCTACCTGGTGAAAATGCCTCTTCAGGAACAGAGCTTATA
GAGACAAAAGTCAAAGGGAAGGAAAATGAGTGCAAAGATATATACCAAAAGTCCACGGTT
TTGAAAGATGATGAATTGAAAACTAAATTGTAA
Chromosome Location
12
Locus
12p12
External Identifiers
ResourceLink
UniProtKB IDP46721
UniProtKB Entry NameSO1A2_HUMAN
GenBank Protein ID885978
GenBank Gene IDU21943
HGNC IDHGNC:10956
General References
  1. Kullak-Ublick GA, Hagenbuch B, Stieger B, Schteingart CD, Hofmann AF, Wolkoff AW, Meier PJ: Molecular and functional characterization of an organic anion transporting polypeptide cloned from human liver. Gastroenterology. 1995 Oct;109(4):1274-82. [PubMed:7557095]
  2. Konig J, Cui Y, Nies AT, Keppler D: Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide. J Biol Chem. 2000 Jul 28;275(30):23161-8. [PubMed:10779507]
  3. Speek M: Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes. Mol Cell Biol. 2001 Mar;21(6):1973-85. [PubMed:11238933]
  4. Bailey DG, Dresser GK, Leake BF, Kim RB: Naringin is a major and selective clinical inhibitor of organic anion-transporting polypeptide 1A2 (OATP1A2) in grapefruit juice. Clin Pharmacol Ther. 2007 Apr;81(4):495-502. doi: 10.1038/sj.clpt.6100104. Epub 2007 Feb 14. [PubMed:17301733]
  5. Lee W, Glaeser H, Smith LH, Roberts RL, Moeckel GW, Gervasini G, Leake BF, Kim RB: Polymorphisms in human organic anion-transporting polypeptide 1A2 (OATP1A2): implications for altered drug disposition and central nervous system drug entry. J Biol Chem. 2005 Mar 11;280(10):9610-7. Epub 2005 Jan 4. [PubMed:15632119]
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateinhibitorinducerDetails
DB01586Ursodeoxycholic acidapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB02659Cholic AcidapprovedunknownsubstrateinhibitorinducerDetails
DB00624Testosteroneapproved, investigationalunknowninhibitorinducerDetails
DB00669Sumatriptanapproved, investigationalunknowninducerDetails
DB01183Naloxoneapproved, vet_approvedunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknownsubstrateinhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB01045RifampicinapprovedunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00227Lovastatinapproved, investigationalunknowninhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB00224IndinavirapprovedunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB01124Tolbutamideapproved, investigationalunknowninhibitorDetails
DB00468QuinineapprovedunknowninhibitorDetails
DB00788Naproxenapproved, vet_approvedunknowninhibitorDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB00328Indometacinapproved, investigationalunknownsubstrateinhibitorDetails
DB01050IbuprofenapprovedunknowninhibitorDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB00091Ciclosporinapproved, investigational, vet_approvedunknowninhibitorDetails
DB02123Glycochenodeoxycholic AcidexperimentalunknownsubstrateinhibitorDetails
DB03619Deoxycholic AcidapprovedunknownsubstrateinhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB00741Hydrocortisoneapproved, vet_approvedunknowninhibitorDetails
DB04630Aldosteroneexperimental, investigationalunknowninhibitorDetails
DB00655EstroneapprovedunknowninhibitorDetails
DB04573Estriolapproved, investigational, vet_approvedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB00635Prednisoneapproved, vet_approvedunknowninhibitorDetails
DB00860Prednisoloneapproved, vet_approvedunknowninhibitorDetails
DB01396Digitoxinapproved, investigationalunknowninhibitorDetails
DB01092OuabainapprovedunknownsubstrateinhibitorDetails
DB00641SimvastatinapprovedunknowninhibitorDetails
DB00175PravastatinapprovedunknowninhibitorDetails
DB01076AtorvastatinapprovedunknowninhibitorDetails
DB00584Enalaprilapproved, vet_approvedunknownsubstrateDetails
DB00917DinoprostoneapprovedunknownsubstrateDetails
DB00279Liothyronineapproved, vet_approvedunknownsubstrateDetails
DB00950Fexofenadineapproved, investigationalunknownsubstrateDetails
DB00728RocuroniumapprovedunknownsubstrateDetails
DB00390DigoxinapprovedunknownsubstrateDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB00887BumetanideapprovedunknownsubstrateDetails
DB00345Aminohippuric acidapproved, investigationalunknownsubstrateDetails
DB01583LiotrixapprovedunknownsubstrateDetails
DB06710MethyltestosteroneapprovedunknowninhibitorinducerDetails
DB02691Glycocholic acidexperimental, investigationalunknownDetails
DB05804Prasterone sulfateinvestigationalunknownDetails
DB00451LevothyroxineapprovedunknowninhibitorDetails
DB00291ChlorambucilapprovedunknownDetails
DB08834Tauroursodeoxycholic acidexperimental, investigationalunknownDetails
DB08836Temocaprilexperimental, investigationalunknownDetails
DB01098RosuvastatinapprovedunknownDetails
DB08893MirabegronapprovedunknownsubstrateDetails
DB01045RifampicinapprovedunknownDetails
DB11611LifitegrastapprovedunknownsubstrateDetails
DB11591Bilastineapproved, investigationalnosubstrateDetails
DB13943Testosterone cypionateapprovedunknowninhibitorinducerDetails
DB13944Testosterone enanthateapprovedunknowninhibitorinducerDetails
DB13946Testosterone undecanoateapproved, investigationalunknowninhibitorinducerDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails
DB01590EverolimusapprovedunknowninhibitorDetails
DB14538Hydrocortisone aceponateexperimental, vet_approvedunknownDetails
DB14539Hydrocortisone acetateapproved, vet_approvedunknownDetails
DB14540Hydrocortisone butyrateapproved, vet_approvedunknownDetails
DB14541Hydrocortisone cypionateapproved, investigational, vet_approvedunknownDetails
DB14542Hydrocortisone phosphateapproved, vet_approvedunknownDetails
DB14543Hydrocortisone probutateapproved, vet_approvedunknownDetails
DB14544Hydrocortisone valerateapproved, vet_approvedunknownDetails
DB14641Estriol tripropionateexperimentalunknownDetails
DB09213Dexibuprofenapproved, investigationalunknownDetails
DB11753Rifamycinapproved, investigationalnoinhibitorDetails