Solute carrier family 22 member 8

Details

Name
Solute carrier family 22 member 8
Synonyms
  • hOAT3
  • OAT3
  • Organic anion transporter 3
Gene Name
SLC22A8
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007005|Solute carrier family 22 member 8
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
Number of residues
542
Molecular Weight
59855.585
Theoretical pI
9.05
GO Classification
Functions
inorganic anion exchanger activity / sodium-independent organic anion transmembrane transporter activity
Processes
anion transmembrane transport / response to toxic substance / sodium-independent organic anion transport / transmembrane transport
Components
basolateral plasma membrane / extracellular exosome / integral component of plasma membrane / plasma membrane
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone-3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA).
Pfam Domain Function
Transmembrane Regions
10-30 124-144 155-175 177-197 213-233 237-257 328-348 355-375 387-407 412-432 472-492
Cellular Location
Basolateral cell membrane
Gene sequence
>lcl|BSEQ0019450|Solute carrier family 22 member 8 (SLC22A8)
ATGACCTTCTCGGAGATCCTGGACCGTGTGGGAAGCATGGGCCATTTCCAGTTCCTGCAT
GTAGCCATACTGGGCCTCCCGATCCTCAACATGGCCAACCACAACCTGCTGCAGATCTTC
ACAGCCGCCACCCCTGTCCACCACTGTCGCCCGCCCCACAATGCCTCCACAGGGCCTTGG
GTGCTCCCCATGGGCCCAAATGGGAAGCCTGAGAGGTGCCTCCGTTTTGTACATCCGCCC
AATGCCAGCCTGCCCAATGACACCCAGAGGGCCATGGAGCCATGCCTGGATGGCTGGGTC
TACAACAGCACCAAGGACTCCATTGTGACAGAGTGGGACTTGGTGTGCAACTCCAACAAA
CTGAAGGAGATGGCCCAGTCTATCTTCATGGCAGGTATACTGATTGGAGGGCTCGTGCTT
GGAGACCTGTCTGACAGGTTTGGCCGCAGGCCCATCCTGACCTGCAGCTACCTGCTGCTG
GCAGCCAGCGGCTCCGGTGCAGCCTTCAGCCCCACCTTCCCCATCTACATGGTCTTCCGC
TTCCTGTGTGGCTTTGGCATCTCAGGCATTACCCTGAGCACCGTCATCTTGAATGTGGAA
TGGGTGCCTACCCGGATGCGGGCCATCATGTCGACAGCACTCGGGTACTGCTACACCTTT
GGCCAGTTCATTCTGCCCGGCCTGGCCTACGCCATCCCCCAGTGGCGTTGGCTGCAGTTA
ACTGTGTCCATTCCCTTCTTCGTCTTCTTCCTATCATCCTGGTGGACACCAGAGTCCATA
CGCTGGTTGGTCTTGTCTGGAAAGTCCTCGAAGGCCCTGAAGATACTCCGGCGGGTGGCT
GTCTTCAATGGCAAGAAGGAAGAGGGAGAAAGGCTCAGCTTGGAGGAGCTCAAACTCAAC
CTGCAGAAGGAGATCTCCTTGGCCAAGGCCAAGTACACCGCAAGTGACCTGTTCCGGATA
CCCATGCTGCGCCGCATGACCTTCTGTCTTTCCCTGGCCTGGTTTGCTACCGGTTTTGCC
TACTATAGTTTGGCTATGGGTGTGGAAGAATTTGGAGTCAACCTCTACATCCTCCAGATC
ATCTTTGGTGGGGTCGATGTCCCAGCCAAGTTCATCACCATCCTCTCCTTAAGCTACCTG
GGCCGGCATACCACTCAGGCCGCTGCCCTGCTCCTGGCAGGAGGGGCCATCTTGGCTCTC
ACCTTTGTGCCCTTGGACTTGCAGACCGTGAGGACAGTATTGGCTGTGTTTGGGAAGGGA
TGCCTATCCAGCTCCTTCAGCTGCCTCTTCCTCTACACAAGTGAATTATACCCCACAGTC
ATCAGGCAAACAGGTATGGGCGTAAGTAACCTGTGGACCCGCGTGGGAAGCATGGTGTCC
CCGCTGGTGAAAATCACGGGTGAGGTACAGCCCTTCATCCCCAATATCATCTACGGGATC
ACCGCCCTCCTCGGGGGCAGTGCTGCCCTCTTCCTGCCTGAGACCCTGAATCAGCCCTTG
CCAGAGACTATCGAAGACCTGGAAAACTGGTCCCTGCGGGCAAAGAAGCCAAAGCAGGAG
CCAGAGGTGGAAAAGGCCTCCCAGAGGATCCCTCTACAGCCTCACGGACCAGGCCTGGGC
TCCAGCTGA
Chromosome Location
11
Locus
11q11
External Identifiers
ResourceLink
UniProtKB IDQ8TCC7
UniProtKB Entry NameS22A8_HUMAN
GenBank Protein ID4378059
GenBank Gene IDAF097491
HGNC IDHGNC:10972
General References
  1. Race JE, Grassl SM, Williams WJ, Holtzman EJ: Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3). Biochem Biophys Res Commun. 1999 Feb 16;255(2):508-14. [PubMed:10049739]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Motohashi H, Sakurai Y, Saito H, Masuda S, Urakami Y, Goto M, Fukatsu A, Ogawa O, Inui K: Gene expression levels and immunolocalization of organic ion transporters in the human kidney. J Am Soc Nephrol. 2002 Apr;13(4):866-74. [PubMed:11912245]
  6. Bakhiya A, Bahn A, Burckhardt G, Wolff N: Human organic anion transporter 3 (hOAT3) can operate as an exchanger and mediate secretory urate flux. Cell Physiol Biochem. 2003;13(5):249-56. [PubMed:14586168]
  7. Srimaroeng C, Chatsudthipong V, Aslamkhan AG, Pritchard JB: Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8). J Pharmacol Exp Ther. 2005 May;313(2):621-8. Epub 2005 Jan 11. [PubMed:15644426]
  8. Tahara H, Shono M, Kusuhara H, Kinoshita H, Fuse E, Takadate A, Otagiri M, Sugiyama Y: Molecular cloning and functional analyses of OAT1 and OAT3 from cynomolgus monkey kidney. Pharm Res. 2005 Apr;22(4):647-60. Epub 2005 Apr 7. [PubMed:15846473]
  9. Tahara H, Kusuhara H, Maeda K, Koepsell H, Fuse E, Sugiyama Y: Inhibition of oat3-mediated renal uptake as a mechanism for drug-drug interaction between fexofenadine and probenecid. Drug Metab Dispos. 2006 May;34(5):743-7. doi: 10.1124/dmd.105.008375. Epub 2006 Feb 2. [PubMed:16455804]
  10. Nishizato Y, Ieiri I, Suzuki H, Kimura M, Kawabata K, Hirota T, Takane H, Irie S, Kusuhara H, Urasaki Y, Urae A, Higuchi S, Otsubo K, Sugiyama Y: Polymorphisms of OATP-C (SLC21A6) and OAT3 (SLC22A8) genes: consequences for pravastatin pharmacokinetics. Clin Pharmacol Ther. 2003 Jun;73(6):554-65. [PubMed:12811365]
  11. Erdman AR, Mangravite LM, Urban TJ, Lagpacan LL, Castro RA, de la Cruz M, Chan W, Huang CC, Johns SJ, Kawamoto M, Stryke D, Taylor TR, Carlson EJ, Ferrin TE, Brett CM, Burchard EG, Giacomini KM: The human organic anion transporter 3 (OAT3; SLC22A8): genetic variation and functional genomics. Am J Physiol Renal Physiol. 2006 Apr;290(4):F905-12. Epub 2005 Nov 15. [PubMed:16291576]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01032Probenecidapproved, investigationalyesinhibitorDetails
DB00624Testosteroneapproved, investigationalunknowninducerDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateinhibitorDetails
DB00936Salicylic acidapproved, investigational, vet_approvedunknowninhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB01053Benzylpenicillinapproved, vet_approvedunknownsubstrateinhibitorDetails
DB01092OuabainapprovedunknowninhibitorDetails
DB00328Indometacinapproved, investigationalunknowninhibitorDetails
DB01050IbuprofenapprovedunknowninhibitorDetails
DB00536GuanidineapprovedunknowninhibitorDetails
DB03553Glutaric AcidexperimentalunknownsubstrateinhibitorDetails
DB00695Furosemideapproved, vet_approvedunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB02659Cholic AcidapprovedunknownsubstrateinhibitorDetails
DB00887BumetanideapprovedunknowninhibitorDetails
DB01597Cilastatinapproved, investigationalunknowninhibitorDetails
DB00554Piroxicamapproved, investigationalunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknownsubstrateinhibitorDetails
DB04519Caprylic acidinvestigationalunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknownsubstrateinhibitorDetails
DB00168Aspartameinvestigational, nutraceuticalunknowninhibitorDetails
DB00759Tetracyclineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00595Oxytetracyclineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01017Minocyclineapproved, investigationalunknowninhibitorDetails
DB01004Ganciclovirapproved, investigationalunknowninhibitorDetails
DB00787AcyclovirapprovedunknownsubstrateinhibitorDetails
DB00917DinoprostoneapprovedunknownsubstrateinhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedunknowninhibitorDetails
DB01329Cefoperazoneapproved, investigationalunknowninhibitorDetails
DB01327CefazolinapprovedunknowninhibitorDetails
DB01326Cefamandoleapproved, experimentalunknowninhibitorDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnunknowninhibitorDetails
DB01212CeftriaxoneapprovedunknowninhibitorDetails
DB00493CefotaximeapprovedunknowninhibitorDetails
DB00812Phenylbutazoneapproved, vet_approvedunknowninhibitorDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB00175PravastatinapprovednosubstrateinhibitorDetails
DB00927FamotidineapprovedunknownsubstrateinhibitorDetails
DB00279Liothyronineapproved, vet_approvedunknowninhibitorDetails
DB00563MethotrexateapprovedunknownsubstrateinhibitorDetails
DB00286Conjugated estrogensapprovedunknownsubstrateinhibitorDetails
DB00469TenoxicamapprovedunknowninhibitorDetails
DB00584Enalaprilapproved, vet_approvedunknowninhibitorDetails
DB01650trans-2-hydroxycinnamic acidexperimentalunknowninhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateinhibitorDetails
DB01065Melatoninapproved, nutraceutical, vet_approvedunknowninhibitorDetails
DB03793Benzoic Acidapproved, investigationalunknowninhibitorDetails
DB01033MercaptopurineapprovedunknownsubstrateinhibitorDetails
DB01051Novobiocinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00213PantoprazoleapprovedunknowninhibitorDetails
DB00139Succinic acidapproved, nutraceuticalunknownsubstrateDetails
DB02527Cyclic adenosine monophosphateexperimentalunknownsubstrateDetails
DB00577Valaciclovirapproved, investigationalunknownsubstrateDetails
DB03902Oxalic AcidexperimentalunknownsubstrateDetails
DB00863RanitidineapprovedunknownsubstrateDetails
DB00583Levocarnitineapproved, investigationalunknownsubstrateDetails
DB00437AllopurinolapprovedunknownsubstrateDetails
DB00198OseltamivirapprovedunknownsubstrateDetails
DB01583LiotrixapprovedunknowninhibitorDetails
DB01414Cefacetrileexperimental, vet_approvedunknownsubstrateinhibitorDetails
DB06710MethyltestosteroneapprovedunknowninducerDetails
DB00495ZidovudineapprovedunknownsubstrateinhibitorDetails
DB08844Uric acidinvestigationalunknownDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateDetails
DB05804Prasterone sulfateinvestigationalunknownDetails
DB01160Dinoprost tromethamineapproved, vet_approvedunknownDetails
DB04133Degraded CephaloridineexperimentalunknownDetails
DB08837Tetraethylammoniumexperimental, investigationalunknownDetails
DB06335SaxagliptinapprovedunknownsubstrateDetails
DB08912Dabrafenibapproved, investigationalunknowninhibitorDetails
DB00300Tenofovir disoproxilapproved, investigationalunknownsubstrateDetails
DB00493CefotaximeapprovedunknownDetails
DB01212CeftriaxoneapprovedunknownDetails
DB01053Benzylpenicillinapproved, vet_approvedunknownDetails
DB09272Eluxadolineapproved, investigationalunknownsubstrateDetails
DB09060AvibactamapprovednosubstrateDetails
DB01685TopiroxostatexperimentalunknowninhibitorDetails
DB05016Atalurenapproved, investigationalnoinhibitorDetails
DB13874Enasidenibapproved, investigationalunknowninhibitorDetails
DB12070Letermovirapproved, investigationalunknowninhibitorDetails
DB08930DolutegravirapprovednoinhibitorDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB11817Baricitinibapproved, investigationalunknownsubstrateinhibitorDetails
DB13943Testosterone cypionateapprovedunknowninducerDetails
DB13944Testosterone enanthateapprovedunknowninducerDetails
DB13946Testosterone undecanoateapproved, investigationalunknowninducerDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownDetails
DB11901Apalutamideapproved, investigationalunknowninhibitorDetails
DB11995Avatrombopagapproved, investigationalunknowninhibitorDetails
DB00655EstroneapprovedunknownsubstrateDetails
DB00833CefaclorapprovedunknownsubstrateinhibitorDetails
DB00535CefdinirapprovedunknownsubstrateinhibitorDetails
DB00229Cefotiamapproved, investigationalunknownsubstrateinhibitorDetails
DB01415Ceftibutenapproved, investigationalunknownsubstrateinhibitorDetails
DB01332Ceftizoximeapproved, investigationalunknownsubstrateinhibitorDetails
DB09008Cefaloridineexperimental, withdrawnunknownsubstrateinhibitorDetails
DB00741Hydrocortisoneapproved, vet_approvedunknownsubstrateDetails
DB12243Edaravoneapproved, investigationalunknownsubstrateDetails
DB00950Fexofenadineapproved, investigationalunknownsubstrateDetails
DB00650LeucovorinapprovedunknownsubstrateinhibitorDetails
DB00881Quinaprilapproved, investigationalunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateinhibitorDetails
DB01261Sitagliptinapproved, investigationalunknownsubstrateDetails
DB14538Hydrocortisone aceponateexperimental, vet_approvedunknownDetails
DB14539Hydrocortisone acetateapproved, vet_approvedunknownDetails
DB14540Hydrocortisone butyrateapproved, vet_approvedunknownDetails
DB14541Hydrocortisone cypionateapproved, investigational, vet_approvedunknownDetails
DB14542Hydrocortisone phosphateapproved, vet_approvedunknownDetails
DB14543Hydrocortisone probutateapproved, vet_approvedunknownDetails
DB14544Hydrocortisone valerateapproved, vet_approvedunknownDetails
DB14568Ivosidenibapproved, investigationalunknowninhibitorDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB00319PiperacillinapprovedunknownsubstrateDetails
DB01606TazobactamapprovedunknownsubstrateinhibitorDetails
DB01045RifampicinapprovedunknowninhibitorDetails
DB11751CabotegravirinvestigationalunknowninhibitorDetails
DB09213Dexibuprofenapproved, investigationalunknownDetails
DB12866PradigastatinvestigationalunknowninhibitorDetails
DB00642Pemetrexedapproved, investigationalunknownsubstrateDetails
DB00448Lansoprazoleapproved, investigationalunknowninhibitorDetails
DB06211Doripenemapproved, investigationalnosubstrateDetails
DB00945Acetylsalicylic acidapproved, vet_approvedunknowninhibitorDetails
DB00736Esomeprazoleapproved, investigationalunknowninhibitorDetails
DB09299Tenofovir alafenamideapprovednosubstrateDetails
DB14126Tenofovirexperimental, investigationalnosubstrateDetails