Bile salt export pump

Details

Name
Bile salt export pump
Synonyms
  • ATP-binding cassette sub-family B member 11
  • BSEP
Gene Name
ABCB11
Organism
Human
Amino acid sequence
>lcl|BSEQ0010492|Bile salt export pump
MSDSVILRSIKKFGEENDGFESDKSYNNDKKSRLQDEKKGDGVRVGFFQLFRFSSSTDIW
LMFVGSLCAFLHGIAQPGVLLIFGTMTDVFIDYDVELQELQIPGKACVNNTIVWTNSSLN
QNMTNGTRCGLLNIESEMIKFASYYAGIAVAVLITGYIQICFWVIAAARQIQKMRKFYFR
RIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQMALFIQRMTSTICGFLLGFFRGWK
LTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISSMRTVAAFGGEKRE
VERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWYGSTLVLDEGEYTPGTLV
QIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRKPIIDCMSEDGYKLDRIKGEI
EFHNVTFHYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVT
VDGHDIRSLNIQWLRDQIGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKEANAYNF
IMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEAMVQEV
LSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVERGTHEELLERKGVYFTLVTLQSQG
NQALNEEDIKDATEDDMLARTFSRGSYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST
YEEDRKDKDIPVQEEVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQIL
GTFSIPDKEEQRSQINGVCLLFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAML
GQDIAWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL
SLVILCFFPFLALSGATQTRMLTGFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFI
EALETELEKPFKTAIQKANIYGFCFAFAQCIMFIANSASYRYGGYLISNEGLHFSYVFRV
ISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDF
VDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMID
GHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDF
VMSLPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQVA
LDKAREGRTCIVIAHRLSTIQNADIIAVMAQGVVIEKGTHEELMAQKGAYYKLVTTGSPI
S
Number of residues
1321
Molecular Weight
146405.83
Theoretical pI
6.52
GO Classification
Functions
transporter activity / ATP binding / bile acid-exporting ATPase activity / canalicular bile acid transmembrane transporter activity / sodium-exporting ATPase activity, phosphorylative mechanism
Processes
bile acid metabolic process / transport / bile acid and bile salt transport / small molecule metabolic process / canalicular bile acid transport / sodium ion transmembrane transport / bile acid biosynthetic process
Components
membrane / intercellular canaliculus / plasma membrane / extracellular exosome / integral component of plasma membrane / apical part of cell
General Function
Transporter activity
Specific Function
Involved in the ATP-dependent secretion of bile salts into the canaliculus of hepatocytes.
Pfam Domain Function
Transmembrane Regions
63-83 148-168 216-236 241-261 320-340 354-374 756-776 795-815 870-890 891-911 980-1000 1012-1032
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010493|Bile salt export pump (ABCB11)
ATGTCTGACTCAGTAATTCTTCGAAGTATAAAGAAATTTGGAGAGGAGAATGATGGTTTT
GAGTCAGATAAATCATATAATAATGATAAGAAATCAAGGTTACAAGATGAGAAGAAAGGT
GATGGCGTTAGAGTTGGCTTCTTTCAATTGTTTCGGTTTTCTTCATCAACTGACATTTGG
CTGATGTTTGTGGGAAGTTTGTGTGCATTTCTCCATGGAATAGCCCAGCCAGGCGTGCTA
CTCATTTTTGGCACAATGACAGATGTTTTTATTGACTACGACGTTGAGTTACAAGAACTC
CAGATTCCAGGAAAAGCATGTGTGAATAACACCATTGTATGGACTAACAGTTCCCTCAAC
CAGAACATGACAAATGGAACACGTTGTGGGTTGCTGAACATCGAGAGCGAAATGATCAAA
TTTGCCAGTTACTATGCTGGAATTGCTGTCGCAGTACTTATCACAGGATATATTCAAATA
TGCTTTTGGGTCATTGCCGCAGCTCGTCAGATACAGAAAATGAGAAAATTTTACTTTAGG
AGAATAATGAGAATGGAAATAGGGTGGTTTGACTGCAATTCAGTGGGGGAGCTGAATACA
AGATTCTCTGATGATATTAATAAAATCAATGATGCCATAGCTGACCAAATGGCCCTTTTC
ATTCAGCGCATGACCTCGACCATCTGTGGTTTCCTGTTGGGATTTTTCAGGGGTTGGAAA
CTGACCTTGGTTATTATTTCTGTCAGCCCTCTCATTGGGATTGGAGCAGCCACCATTGGT
CTGAGTGTGTCCAAGTTTACGGACTATGAGCTGAAGGCCTATGCCAAAGCAGGGGTGGTG
GCTGATGAAGTCATTTCATCAATGAGAACAGTGGCTGCTTTTGGTGGTGAGAAAAGAGAG
GTTGAAAGGTATGAGAAAAATCTTGTGTTCGCCCAGCGTTGGGGAATTAGAAAAGGAATA
GTGATGGGATTCTTTACTGGATTCGTGTGGTGTCTCATCTTTTTGTGTTATGCACTGGCC
TTCTGGTACGGCTCCACACTTGTCCTGGATGAAGGAGAATATACACCAGGAACCCTTGTC
CAGATTTTCCTCAGTGTCATAGTAGGAGCTTTAAATCTTGGCAATGCCTCTCCTTGTTTG
GAAGCCTTTGCAACTGGACGTGCAGCAGCCACCAGCATTTTTGAGACAATAGACAGGAAA
CCCATCATTGACTGCATGTCAGAAGATGGTTACAAGTTGGATCGAATCAAGGGTGAAATT
GAATTCCATAATGTGACCTTCCATTATCCTTCCAGACCAGAGGTGAAGATTCTAAATGAC
CTCAACATGGTCATTAAACCAGGGGAAATGACAGCTCTGGTAGGACCCAGTGGAGCTGGA
AAAAGTACAGCACTGCAACTCATTCAGCGATTCTATGACCCCTGTGAAGGAATGGTGACC
GTGGATGGCCATGACATTCGCTCTCTTAACATTCAGTGGCTTAGAGATCAGATTGGGATA
GTGGAGCAAGAGCCAGTTCTGTTCTCTACCACCATTGCAGAAAATATTCGCTATGGCAGA
GAAGATGCAACAATGGAAGACATAGTCCAAGCTGCCAAGGAGGCCAATGCCTACAACTTC
ATCATGGACCTGCCACAGCAATTTGACACCCTTGTTGGAGAAGGAGGAGGCCAGATGAGT
GGTGGCCAGAAACAAAGGGTAGCTATCGCCAGAGCCCTCATCCGAAATCCCAAGATTCTG
CTTTTGGACATGGCCACCTCAGCTCTGGACAATGAGAGTGAAGCCATGGTGCAAGAAGTG
CTGAGTAAGATTCAGCATGGGCACACAATCATTTCAGTTGCTCATCGCTTGTCTACGGTC
AGAGCTGCAGATACCATCATTGGTTTTGAACATGGCACTGCAGTGGAAAGAGGGACCCAT
GAAGAATTACTGGAAAGGAAAGGTGTTTACTTCACTCTAGTGACTTTGCAAAGCCAGGGA
AATCAAGCTCTTAATGAAGAGGACATAAAGGATGCAACTGAAGATGACATGCTTGCGAGG
ACCTTTAGCAGAGGGAGCTACCAGGATAGTTTAAGGGCTTCCATCCGGCAACGCTCCAAG
TCTCAGCTTTCTTACCTGGTGCACGAACCTCCATTAGCTGTTGTAGATCATAAGTCTACC
TATGAAGAAGATAGAAAGGACAAGGACATTCCTGTGCAGGAAGAAGTTGAACCTGCCCCA
GTTAGGAGGATTCTGAAATTCAGTGCTCCAGAATGGCCCTACATGCTGGTAGGGTCTGTG
GGTGCAGCTGTGAACGGGACAGTCACACCCTTGTATGCCTTTTTATTCAGCCAGATTCTT
GGGACTTTTTCAATTCCTGATAAAGAGGAACAAAGGTCACAGATCAATGGTGTGTGCCTA
CTTTTTGTAGCAATGGGCTGTGTATCTCTTTTCACCCAATTTCTACAGGGATATGCCTTT
GCTAAATCTGGGGAGCTCCTAACAAAAAGGCTACGTAAATTTGGTTTCAGGGCAATGCTG
GGGCAAGATATTGCCTGGTTTGATGACCTCAGAAATAGCCCTGGAGCATTGACAACAAGA
CTTGCTACAGATGCTTCCCAAGTTCAAGGGGCTGCCGGCTCTCAGATCGGGATGATAGTC
AATTCCTTCACTAACGTCACTGTGGCCATGATCATTGCCTTCTCCTTTAGCTGGAAGCTG
AGCCTGGTCATCTTGTGCTTCTTCCCCTTCTTGGCTTTATCAGGAGCCACACAGACCAGG
ATGTTGACAGGATTTGCCTCTCGAGATAAGCAGGCCCTGGAGATGGTGGGACAGATTACA
AATGAAGCCCTCAGTAACATCCGCACTGTTGCTGGAATTGGAAAGGAGAGGCGGTTCATT
GAAGCACTTGAGACTGAGCTGGAGAAGCCCTTCAAGACAGCCATTCAGAAAGCCAATATT
TACGGATTCTGCTTTGCCTTTGCCCAGTGCATCATGTTTATTGCGAATTCTGCTTCCTAC
AGATATGGAGGTTACTTAATCTCCAATGAGGGGCTCCATTTCAGCTATGTGTTCAGGGTG
ATCTCTGCAGTTGTACTGAGTGCAACAGCTCTTGGAAGAGCCTTCTCTTACACCCCAAGT
TATGCAAAAGCTAAAATATCAGCTGCACGCTTTTTTCAACTGCTGGACCGACAACCCCCA
ATCAGTGTATACAATACTGCAGGTGAAAAATGGGACAACTTCCAGGGGAAGATTGATTTT
GTTGATTGTAAATTTACATATCCTTCTCGACCTGACTCGCAAGTTCTGAATGGTCTCTCA
GTGTCGATTAGTCCAGGGCAGACACTGGCGTTTGTTGGGAGCAGTGGATGTGGCAAAAGC
ACTAGCATTCAGCTGTTGGAACGTTTCTATGATCCTGATCAAGGGAAGGTGATGATAGAT
GGTCATGACAGCAAAAAAGTAAATGTCCAGTTCCTCCGCTCAAACATTGGAATTGTTTCC
CAGGAACCAGTGTTGTTTGCCTGTAGCATAATGGACAATATCAAGTATGGAGACAACACC
AAAGAAATTCCCATGGAAAGAGTCATAGCAGCTGCAAAACAGGCTCAGCTGCATGATTTT
GTCATGTCACTCCCAGAGAAATATGAAACTAACGTTGGGTCCCAGGGGTCTCAACTCTCT
AGAGGGGAGAAACAACGCATTGCTATTGCTCGGGCCATTGTACGAGATCCTAAAATCTTG
CTACTAGATGAAGCCACTTCTGCCTTAGACACAGAAAGTGAAAAGACGGTGCAGGTTGCT
CTAGACAAAGCCAGAGAGGGTCGGACCTGCATTGTCATTGCCCATCGCTTGTCCACCATC
CAGAACGCGGATATCATTGCTGTCATGGCACAGGGGGTGGTGATTGAAAAGGGGACCCAT
GAAGAACTGATGGCCCAAAAAGGAGCCTACTACAAACTAGTCACCACTGGATCCCCCATC
AGTTGA
Chromosome Location
2
Locus
2q24
External Identifiers
ResourceLink
UniProtKB IDO95342
UniProtKB Entry NameABCBB_HUMAN
GenBank Protein ID3873243
GenBank Gene IDAF091582
GenAtlas IDABCB11
HGNC IDHGNC:42
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00171ATPinvestigational, nutraceuticalunknownDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB01586Ursodeoxycholic acidapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB03619Deoxycholic AcidapprovedunknowninducerDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateinducerDetails
DB02659Cholic AcidapprovedunknownsubstrateinhibitorinducerDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB00977EthinylestradiolapprovedunknowninhibitorinducerDetails
DB01045RifampicinapprovedunknowninhibitorDetails
DB02123Glycochenodeoxycholic AcidexperimentalunknownsubstrateinhibitorDetails
DB01016GlyburideapprovedunknownsubstrateinhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00845Clofazimineapproved, investigationalunknowninhibitorDetails
DB00206Reserpineapproved, investigationalunknowninhibitorDetails
DB00570VinblastineapprovednosubstrateinhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninhibitorDetails
DB01229Paclitaxelapproved, vet_approvednosubstrateinhibitorDetails
DB02703Fusidic Acidapproved, investigationalunknowninhibitorDetails
DB00559Bosentanapproved, investigationalunknowninhibitorDetails
DB00997Doxorubicinapproved, investigationalunknownsubstrateDetails
DB00694DaunorubicinapprovedunknownsubstrateDetails
DB00693FluoresceinapprovedunknownsubstrateDetails
DB00541Vincristineapproved, investigationalunknownsubstrateDetails
DB00390DigoxinapprovedunknownsubstrateDetails
DB00175PravastatinapprovedunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateDetails
DB00845Clofazimineapproved, investigationalunknownDetails
DB06290SimeprevirapprovedunknowninhibitorDetails
DB12070Letermovirapproved, investigationalunknowninhibitorDetails
DB00932Tipranavirapproved, investigationalunknownsubstrateinhibitorDetails
DB00257Clotrimazoleapproved, vet_approvedunknownsubstrateinhibitorDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB00966Telmisartanapproved, investigationalnosubstrateDetails
DB09374Indocyanine green acid formapproved, investigationalnosubstrateDetails
DB01149Nefazodoneapproved, withdrawnnosubstrateDetails
DB01232Saquinavirapproved, investigationalnosubstrateDetails
DB01601LopinavirapprovednosubstrateDetails
DB00503Ritonavirapproved, investigationalnosubstrateDetails
DB00834Mifepristoneapproved, investigationalnosubstrateDetails
DB00455Loratadineapproved, investigationalnosubstrateDetails
DB13345Dihydroergocristineapproved, experimentalnosubstrateDetails
DB12319Benzbromaroneinvestigational, withdrawnnosubstrateDetails
DB00622Nicardipineapproved, investigationalnosubstrateDetails
DB00227Lovastatinapproved, investigationalnosubstrateDetails
DB01023Felodipineapproved, investigationalnosubstrateDetails
DB00255Diethylstilbestrolapproved, investigationalnosubstrateDetails
DB00678LosartanapprovednosubstrateDetails
DB00222GlimepirideapprovednosubstrateDetails
DB00822DisulfiramapprovednosubstrateDetails
DB00641SimvastatinapprovednosubstrateDetails
DB00421SpironolactoneapprovednosubstrateDetails
DB01076AtorvastatinapprovednosubstrateDetails
DB00439Cerivastatinapproved, withdrawnnosubstrateDetails
DB00270Isradipineapproved, investigationalnosubstrateDetails
DB00973EzetimibeapprovednosubstrateDetails
DB00975DipyridamoleapprovednosubstrateDetails
DB08860PitavastatinapprovednosubstrateDetails
DB01039FenofibrateapprovednosubstrateDetails
DB01072Atazanavirapproved, investigationalnosubstrateDetails
DB00912Repaglinideapproved, investigationalnosubstrateDetails
DB01138SulfinpyrazoneapprovednosubstrateDetails
DB00243Ranolazineapproved, investigationalnosubstrateDetails
DB00683Midazolamapproved, illicitnosubstrateDetails
DB00412Rosiglitazoneapproved, investigationalnosubstrateDetails
DB00220NelfinavirapprovednosubstrateDetails
DB01222BudesonideapprovednosubstrateDetails
DB00224IndinavirapprovednosubstrateDetails
DB00482Celecoxibapproved, investigationalnosubstrateDetails
DB00833CefaclorapprovednosubstrateDetails
DB05804Prasterone sulfateinvestigationalnosubstrateDetails
DB00637Astemizoleapproved, withdrawnnosubstrateDetails
DB01118Amiodaroneapproved, investigationalnosubstrateDetails
DB00911Tinidazoleapproved, investigationalnosubstrateDetails
DB12712PilsicainideinvestigationalnosubstrateDetails
DB00698Nitrofurantoinapproved, vet_approvednosubstrateDetails
DB00619ImatinibapprovednosubstrateDetails
DB00328Indomethacinapproved, investigationalnosubstrateDetails
DB00176Fluvoxamineapproved, investigationalnosubstrateDetails
DB01165OfloxacinapprovednosubstrateDetails
DB01067Glipizideapproved, investigationalnosubstrateDetails
DB00275Olmesartanapproved, investigationalnosubstrateDetails
DB00335AtenololapprovednosubstrateDetails
DB00625Efavirenzapproved, investigationalnosubstrateDetails
DB00342Terfenadineapproved, withdrawnnosubstrateDetails
DB01211ClarithromycinapprovednosubstrateDetails
DB13751Glycyrrhizic acidapproved, experimentalnosubstrateDetails
DB00572Atropineapproved, vet_approvednosubstrateDetails
DB00301Flucloxacillinapproved, investigationalnosubstrateDetails
DB01054Nitrendipineapproved, investigationalnosubstrateDetails
DB00199Erythromycinapproved, investigational, vet_approvednosubstrateDetails
DB00586Diclofenacapproved, vet_approvednosubstrateDetails
DB01115NifedipineapprovednosubstrateDetails
DB01015SulfamethoxazoleapprovednosubstrateDetails
DB00788Naproxenapproved, vet_approvednosubstrateDetails
DB00477Chlorpromazineapproved, investigational, vet_approvednoinhibitorDetails
DB00501Cimetidineapproved, investigationalnoinhibitorDetails
DB00908Quinidineapproved, investigationalnoinhibitorDetails
DB00675TamoxifenapprovednoinhibitorDetails
DB14057ValinomycinexperimentalnoinhibitorDetails
DB00661VerapamilapprovednosubstrateDetails