ATP-binding cassette sub-family G member 2

Details

Name
ATP-binding cassette sub-family G member 2
Synonyms
  • ABCP
  • BCRP
  • BCRP1
  • Breast cancer resistance protein
  • CDw338
  • Mitoxantrone resistance-associated protein
  • MXR
  • Placenta-specific ATP-binding cassette transporter
  • Urate exporter
Gene Name
ABCG2
Organism
Human
Amino acid sequence
>lcl|BSEQ0002125|ATP-binding cassette sub-family G member 2
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Number of residues
655
Molecular Weight
72313.47
Theoretical pI
8.9
GO Classification
Functions
transporter activity / ATP binding / ATPase activity, coupled to transmembrane movement of substances / xenobiotic-transporting ATPase activity / heme transporter activity / protein homodimerization activity
Processes
transmembrane transport / transport / drug transmembrane transport / cellular iron ion homeostasis / urate metabolic process / response to drug / xenobiotic transport / heme transport / small molecule metabolic process
Components
nucleus / plasma membrane / mitochondrial membrane / integral component of membrane
General Function
Xenobiotic-transporting atpase activity
Specific Function
High-capacity urate exporter functioning in both renal and extrarenal urate excretion. Plays a role in porphyrin homeostasis as it is able to mediates the export of protoporhyrin IX (PPIX) both from mitochondria to cytosol and from cytosol to extracellular space, and cellular export of hemin, and heme. Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. Appears to play a major role in the multidrug resistance phenotype of several cancer cell lines. Implicated in the efflux of numerous drugs and xenobiotics: mitoxantrone, the photosensitizer pheophorbide, camptothecin, methotrexate, azidothymidine (AZT), and the anthracyclines daunorubicin and doxorubicin.
Pfam Domain Function
Transmembrane Regions
396-416 429-449 478-498 507-527 536-556 631-651
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016303|ATP-binding cassette sub-family G member 2 (ABCG2)
ATGTCTTCCAGTAATGTCGAAGTTTTTATCCCAGTGTCACAAGGAAACACCAATGGCTTC
CCCGCGACAGCTTCCAATGACCTGAAGGCATTTACTGAAGGAGCTGTGTTAAGTTTTCAT
AACATCTGCTATCGAGTAAAACTGAAGAGTGGCTTTCTACCTTGTCGAAAACCAGTTGAG
AAAGAAATATTATCGAATATCAATGGGATCATGAAACCTGGTCTCAACGCCATCCTGGGA
CCCACAGGTGGAGGCAAATCTTCGTTATTAGATGTCTTAGCTGCAAGGAAAGATCCAAGT
GGATTATCTGGAGATGTTCTGATAAATGGAGCACCGCGACCTGCCAATTTCAAATGTAAT
TCAGGTTACGTGGTACAAGATGATGTTGTGATGGGCACTCTGACGGTGAGAGAAAACTTA
CAGTTCTCAGCAGCTCTTCGGCTTGCAACAACTATGACGAATCATGAAAAAAACGAACGG
ATTAACAGGGTCATTCAAGAGTTAGGTCTGGATAAAGTGGCAGACTCCAAGGTTGGAACT
CAGTTTATCCGTGGTGTGTCTGGAGGAGAAAGAAAAAGGACTAGTATAGGAATGGAGCTT
ATCACTGATCCTTCCATCTTGTTCTTGGATGAGCCTACAACTGGCTTAGACTCAAGCACA
GCAAATGCTGTCCTTTTGCTCCTGAAAAGGATGTCTAAGCAGGGACGAACAATCATCTTC
TCCATTCATCAGCCTCGATATTCCATCTTCAAGTTGTTTGATAGCCTCACCTTATTGGCC
TCAGGAAGACTTATGTTCCACGGGCCTGCTCAGGAGGCCTTGGGATACTTTGAATCAGCT
GGTTATCACTGTGAGGCCTATAATAACCCTGCAGACTTCTTCTTGGACATCATTAATGGA
GATTCCACTGCTGTGGCATTAAACAGAGAAGAAGACTTTAAAGCCACAGAGATCATAGAG
CCTTCCAAGCAGGATAAGCCACTCATAGAAAAATTAGCGGAGATTTATGTCAACTCCTCC
TTCTACAAAGAGACAAAAGCTGAATTACATCAACTTTCCGGGGGTGAGAAGAAGAAGAAG
ATCACAGTCTTCAAGGAGATCAGCTACACCACCTCCTTCTGTCATCAACTCAGATGGGTT
TCCAAGCGTTCATTCAAAAACTTGCTGGGTAATCCCCAGGCCTCTATAGCTCAGATCATT
GTCACAGTCGTACTGGGACTGGTTATAGGTGCCATTTACTTTGGGCTAAAAAATGATTCT
ACTGGAATCCAGAACAGAGCTGGGGTTCTCTTCTTCCTGACGACCAACCAGTGTTTCAGC
AGTGTTTCAGCCGTGGAACTCTTTGTGGTAGAGAAGAAGCTCTTCATACATGAATACATC
AGCGGATACTACAGAGTGTCATCTTATTTCCTTGGAAAACTGTTATCTGATTTATTACCC
ATGAGGATGTTACCAAGTATTATATTTACCTGTATAGTGTACTTCATGTTAGGATTGAAG
CCAAAGGCAGATGCCTTCTTCGTTATGATGTTTACCCTTATGATGGTGGCTTATTCAGCC
AGTTCCATGGCACTGGCCATAGCAGCAGGTCAGAGTGTGGTTTCTGTAGCAACACTTCTC
ATGACCATCTGTTTTGTGTTTATGATGGTCTGTTGGTCAATCTCACAACCATTGCATCTT
GGCTGTCATGGCTTCAGTACTTCAGCATTCCACGATATGGATTTACGGCTTTGCAGCATA
ATGAATTTTTGGGACAAAACTTCTGCCCAGGACTCAATGCAACAGGAAACAATCCTTGTA
ACTATGCAACATGTACTGGCGAAGAATATTTGGTAA
Chromosome Location
4
Locus
4q22
External Identifiers
ResourceLink
UniProtKB IDQ9UNQ0
UniProtKB Entry NameABCG2_HUMAN
GenBank Protein ID4185796
GenBank Gene IDAF103796
GenAtlas IDABCG2
HGNC IDHGNC:74
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04851Biricodar dicitrateinvestigationalunknownDetails
DB00317Gefitinibapproved, investigationalunknownsubstrateinhibitorDetails
DB04216QuercetinexperimentalunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB03467NaringeninexperimentalunknowninhibitorDetails
DB01030Topotecanapproved, investigationalunknownsubstrateinhibitorDetails
DB01051Novobiocinapproved, vet_approvedunknowninhibitorDetails
DB00655EstroneapprovedunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB01094HesperetinapprovedunknowninhibitorDetails
DB01645GenisteininvestigationalunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB01016GlyburideapprovedunknownsubstrateinhibitorDetails
DB00255DiethylstilbestrolapprovedunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorDetails
DB00175PravastatinapprovedunknownsubstrateinhibitorDetails
DB00997Doxorubicinapproved, investigationalunknownsubstrateinhibitorDetails
DB00213PantoprazoleapprovedunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB04348Taurocholic AcidexperimentalunknowninhibitorDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00741Hydrocortisoneapproved, vet_approvedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB01204Mitoxantroneapproved, investigationalunknownsubstrateinhibitorDetails
DB02115DaidzinexperimentalunknowninhibitorDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB01268Sunitinibapproved, investigationalunknowninhibitorDetails
DB00470Dronabinolapproved, illicitunknowninhibitorDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknowninhibitorDetails
DB00795SulfasalazineapprovedunknownsubstrateinhibitorDetails
DB00966Telmisartanapproved, investigationalunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninhibitorDetails
DB01254Dasatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00457PrazosinapprovedunknownsubstrateinhibitorDetails
DB00448Lansoprazoleapproved, investigationalunknowninhibitorDetails
DB01129Rabeprazoleapproved, investigationalunknowninhibitorDetails
DB04881ElacridarinvestigationalunknowninhibitorDetails
DB04868Nilotinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00530Erlotinibapproved, investigationalunknowninhibitorDetails
DB05294VandetanibapprovedunknowninhibitorDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB00773EtoposideapprovedunknownsubstrateDetails
DB00970DactinomycinapprovedunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB00439CerivastatinwithdrawnunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB00675TamoxifenapprovedunknownsubstrateDetails
DB00669Sumatriptanapproved, investigationalunknownsubstrateDetails
DB00694DaunorubicinapprovedunknownsubstrateDetails
DB04540CholesterolexperimentalunknownsubstrateDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB00158Folic Acidapproved, nutraceutical, vet_approvedunknownsubstrateDetails
DB03496Alvocidibexperimental, investigationalunknownsubstrateDetails
DB00541Vincristineapproved, investigationalunknownsubstrateDetails
DB00444TeniposideapprovedunknownsubstrateDetails
DB00698Nitrofurantoinapproved, vet_approvedunknownsubstrateDetails
DB00602Ivermectinapproved, vet_approvedunknownsubstrateDetails
DB04690CamptothecinexperimentalunknownsubstrateDetails
DB00740Riluzoleapproved, investigationalunknownsubstrateDetails
DB00242Cladribineapproved, investigationalunknownsubstrateDetails
DB00631Clofarabineapproved, investigationalunknownsubstrateDetails
DB00526Oxaliplatinapproved, investigationalunknownsubstrateDetails
DB06772CabazitaxelapprovedunknowninhibitorDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB06589PazopanibapprovedunknownsubstrateDetails
DB08864RilpivirineapprovedunknowninhibitorDetails
DB08880TeriflunomideapprovedunknownsubstrateDetails
DB01097Leflunomideapproved, investigationalunknownsubstrateDetails
DB08881VemurafenibapprovedunknownsubstrateDetails
DB06605ApixabanapprovedunknownsubstrateDetails
DB08828VismodegibapprovedunknowninhibitorDetails
DB08896RegorafenibapprovedunknowninhibitorDetails
DB08901PonatinibapprovedunknownsubstrateinhibitorDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB08912DabrafenibapprovedunknownsubstrateinhibitorDetails
DB00549Zafirlukastapproved, investigationalunknownAntagonist Details
DB00285VenlafaxineapprovedunknowninducerDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB08916AfatinibapprovedunknownsubstrateinhibitorDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB00515CisplatinapprovedunknownsubstrateDetails
DB00958CarboplatinapprovedunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB08934SofosbuvirapprovednosubstrateDetails
DB09078LenvatinibapprovednosubstrateDetails
DB09054IdelalisibapprovednosubstrateDetails
DB09065CobicistatapprovedyesinhibitorDetails
DB09291RolapitantapprovednoinhibitorDetails
DB09102DaclatasvirapprovedunknowninhibitorDetails
DB05239Cobimetinibapprovedunknownweak inhibitorDetails
DB09330OsimertinibapprovednosubstrateDetails
DB11363AlectinibapprovednoinhibitorDetails
DB08931RiociguatapprovedyessubstrateDetails
DB09183DasabuvirapprovedunknowninhibitorDetails
DB11581VenetoclaxapprovednosubstrateDetails
DB06654SafinamideapprovedunknownsubstrateDetails
DB11613VelpatasvirapprovednosubstrateinhibitorDetails
DB06290SimeprevirapprovedunknownsubstrateinhibitorDetails
DB09027LedipasvirapprovednotransporterDetails
DB09296OmbitasvirapprovednosubstrateDetails
DB11943Delafloxacinapproved, investigationalnosubstrateDetails
DB01685TopiroxostatapprovedunknowninhibitorDetails
DB12026VoxilaprevirapprovednosubstrateinhibitorDetails
DB13874EnasidenibapprovedunknownsubstrateinhibitorDetails
DB13878PibrentasvirapprovedunknownsubstrateinhibitorDetails
DB13879GlecaprevirapprovedunknownsubstrateinhibitorDetails
DB12483CopanlisibapprovedunknownsubstrateDetails
DB12001AbemaciclibapprovedunknownsubstrateinhibitorDetails