ATP-binding cassette sub-family G member 2

Details

Name
ATP-binding cassette sub-family G member 2
Synonyms
  • ABCP
  • BCRP
  • BCRP1
  • Breast cancer resistance protein
  • CDw338
  • Mitoxantrone resistance-associated protein
  • MXR
  • Placenta-specific ATP-binding cassette transporter
  • Urate exporter
Gene Name
ABCG2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0002125|ATP-binding cassette sub-family G member 2
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Number of residues
655
Molecular Weight
72313.47
Theoretical pI
8.9
GO Classification
Functions
ATP binding / ATPase activity, coupled to transmembrane movement of substances / heme transporter activity / protein homodimerization activity / transporter activity / xenobiotic-transporting ATPase activity
Processes
cellular iron ion homeostasis / drug transmembrane transport / heme transport / response to drug / small molecule metabolic process / transmembrane transport / transport / urate metabolic process / xenobiotic transport
Components
integral component of membrane / mitochondrial membrane / nucleus / plasma membrane
General Function
Xenobiotic-transporting atpase activity
Specific Function
High-capacity urate exporter functioning in both renal and extrarenal urate excretion. Plays a role in porphyrin homeostasis as it is able to mediates the export of protoporhyrin IX (PPIX) both from mitochondria to cytosol and from cytosol to extracellular space, and cellular export of hemin, and heme. Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. Appears to play a major role in the multidrug resistance phenotype of several cancer cell lines. Implicated in the efflux of numerous drugs and xenobiotics: mitoxantrone, the photosensitizer pheophorbide, camptothecin, methotrexate, azidothymidine (AZT), and the anthracyclines daunorubicin and doxorubicin.
Pfam Domain Function
Transmembrane Regions
396-416 429-449 478-498 507-527 536-556 631-651
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016303|ATP-binding cassette sub-family G member 2 (ABCG2)
ATGTCTTCCAGTAATGTCGAAGTTTTTATCCCAGTGTCACAAGGAAACACCAATGGCTTC
CCCGCGACAGCTTCCAATGACCTGAAGGCATTTACTGAAGGAGCTGTGTTAAGTTTTCAT
AACATCTGCTATCGAGTAAAACTGAAGAGTGGCTTTCTACCTTGTCGAAAACCAGTTGAG
AAAGAAATATTATCGAATATCAATGGGATCATGAAACCTGGTCTCAACGCCATCCTGGGA
CCCACAGGTGGAGGCAAATCTTCGTTATTAGATGTCTTAGCTGCAAGGAAAGATCCAAGT
GGATTATCTGGAGATGTTCTGATAAATGGAGCACCGCGACCTGCCAATTTCAAATGTAAT
TCAGGTTACGTGGTACAAGATGATGTTGTGATGGGCACTCTGACGGTGAGAGAAAACTTA
CAGTTCTCAGCAGCTCTTCGGCTTGCAACAACTATGACGAATCATGAAAAAAACGAACGG
ATTAACAGGGTCATTCAAGAGTTAGGTCTGGATAAAGTGGCAGACTCCAAGGTTGGAACT
CAGTTTATCCGTGGTGTGTCTGGAGGAGAAAGAAAAAGGACTAGTATAGGAATGGAGCTT
ATCACTGATCCTTCCATCTTGTTCTTGGATGAGCCTACAACTGGCTTAGACTCAAGCACA
GCAAATGCTGTCCTTTTGCTCCTGAAAAGGATGTCTAAGCAGGGACGAACAATCATCTTC
TCCATTCATCAGCCTCGATATTCCATCTTCAAGTTGTTTGATAGCCTCACCTTATTGGCC
TCAGGAAGACTTATGTTCCACGGGCCTGCTCAGGAGGCCTTGGGATACTTTGAATCAGCT
GGTTATCACTGTGAGGCCTATAATAACCCTGCAGACTTCTTCTTGGACATCATTAATGGA
GATTCCACTGCTGTGGCATTAAACAGAGAAGAAGACTTTAAAGCCACAGAGATCATAGAG
CCTTCCAAGCAGGATAAGCCACTCATAGAAAAATTAGCGGAGATTTATGTCAACTCCTCC
TTCTACAAAGAGACAAAAGCTGAATTACATCAACTTTCCGGGGGTGAGAAGAAGAAGAAG
ATCACAGTCTTCAAGGAGATCAGCTACACCACCTCCTTCTGTCATCAACTCAGATGGGTT
TCCAAGCGTTCATTCAAAAACTTGCTGGGTAATCCCCAGGCCTCTATAGCTCAGATCATT
GTCACAGTCGTACTGGGACTGGTTATAGGTGCCATTTACTTTGGGCTAAAAAATGATTCT
ACTGGAATCCAGAACAGAGCTGGGGTTCTCTTCTTCCTGACGACCAACCAGTGTTTCAGC
AGTGTTTCAGCCGTGGAACTCTTTGTGGTAGAGAAGAAGCTCTTCATACATGAATACATC
AGCGGATACTACAGAGTGTCATCTTATTTCCTTGGAAAACTGTTATCTGATTTATTACCC
ATGAGGATGTTACCAAGTATTATATTTACCTGTATAGTGTACTTCATGTTAGGATTGAAG
CCAAAGGCAGATGCCTTCTTCGTTATGATGTTTACCCTTATGATGGTGGCTTATTCAGCC
AGTTCCATGGCACTGGCCATAGCAGCAGGTCAGAGTGTGGTTTCTGTAGCAACACTTCTC
ATGACCATCTGTTTTGTGTTTATGATGGTCTGTTGGTCAATCTCACAACCATTGCATCTT
GGCTGTCATGGCTTCAGTACTTCAGCATTCCACGATATGGATTTACGGCTTTGCAGCATA
ATGAATTTTTGGGACAAAACTTCTGCCCAGGACTCAATGCAACAGGAAACAATCCTTGTA
ACTATGCAACATGTACTGGCGAAGAATATTTGGTAA
Chromosome Location
4
Locus
4q22
External Identifiers
ResourceLink
UniProtKB IDQ9UNQ0
UniProtKB Entry NameABCG2_HUMAN
GenBank Protein ID4185796
GenBank Gene IDAF103796
GenAtlas IDABCG2
HGNC IDHGNC:74
General References
  1. Allikmets R, Schriml LM, Hutchinson A, Romano-Spica V, Dean M: A human placenta-specific ATP-binding cassette gene (ABCP) on chromosome 4q22 that is involved in multidrug resistance. Cancer Res. 1998 Dec 1;58(23):5337-9. [PubMed:9850061]
  2. Doyle LA, Yang W, Abruzzo LV, Krogmann T, Gao Y, Rishi AK, Ross DD: A multidrug resistance transporter from human MCF-7 breast cancer cells. Proc Natl Acad Sci U S A. 1998 Dec 22;95(26):15665-70. [PubMed:9861027]
  3. Komatani H, Kotani H, Hara Y, Nakagawa R, Matsumoto M, Arakawa H, Nishimura S: Identification of breast cancer resistant protein/mitoxantrone resistance/placenta-specific, ATP-binding cassette transporter as a transporter of NB-506 and J-107088, topoisomerase I inhibitors with an indolocarbazole structure. Cancer Res. 2001 Apr 1;61(7):2827-32. [PubMed:11306452]
  4. Zhou S, Schuetz JD, Bunting KD, Colapietro AM, Sampath J, Morris JJ, Lagutina I, Grosveld GC, Osawa M, Nakauchi H, Sorrentino BP: The ABC transporter Bcrp1/ABCG2 is expressed in a wide variety of stem cells and is a molecular determinant of the side-population phenotype. Nat Med. 2001 Sep;7(9):1028-34. [PubMed:11533706]
  5. Zhang W, Mojsilovic-Petrovic J, Andrade MF, Zhang H, Ball M, Stanimirovic DB: The expression and functional characterization of ABCG2 in brain endothelial cells and vessels. FASEB J. 2003 Nov;17(14):2085-7. Epub 2003 Sep 4. [PubMed:12958161]
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  7. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  9. Miyake K, Mickley L, Litman T, Zhan Z, Robey R, Cristensen B, Brangi M, Greenberger L, Dean M, Fojo T, Bates SE: Molecular cloning of cDNAs which are highly overexpressed in mitoxantrone-resistant cells: demonstration of homology to ABC transport genes. Cancer Res. 1999 Jan 1;59(1):8-13. [PubMed:9892175]
  10. Schmitz G, Langmann T, Heimerl S: Role of ABCG1 and other ABCG family members in lipid metabolism. J Lipid Res. 2001 Oct;42(10):1513-20. [PubMed:11590207]
  11. Xu J, Liu Y, Yang Y, Bates S, Zhang JT: Characterization of oligomeric human half-ABC transporter ATP-binding cassette G2. J Biol Chem. 2004 May 7;279(19):19781-9. Epub 2004 Mar 4. [PubMed:15001581]
  12. Diop NK, Hrycyna CA: N-Linked glycosylation of the human ABC transporter ABCG2 on asparagine 596 is not essential for expression, transport activity, or trafficking to the plasma membrane. Biochemistry. 2005 Apr 12;44(14):5420-9. [PubMed:15807535]
  13. Ozvegy-Laczka C, Koblos G, Sarkadi B, Varadi A: Single amino acid (482) variants of the ABCG2 multidrug transporter: major differences in transport capacity and substrate recognition. Biochim Biophys Acta. 2005 Feb 1;1668(1):53-63. [PubMed:15670731]
  14. Henriksen U, Gether U, Litman T: Effect of Walker A mutation (K86M) on oligomerization and surface targeting of the multidrug resistance transporter ABCG2. J Cell Sci. 2005 Apr 1;118(Pt 7):1417-26. Epub 2005 Mar 15. [PubMed:15769853]
  15. Wakabayashi K, Nakagawa H, Tamura A, Koshiba S, Hoshijima K, Komada M, Ishikawa T: Intramolecular disulfide bond is a critical check point determining degradative fates of ATP-binding cassette (ABC) transporter ABCG2 protein. J Biol Chem. 2007 Sep 21;282(38):27841-6. Epub 2007 Aug 8. [PubMed:17686774]
  16. Dehghan A, Kottgen A, Yang Q, Hwang SJ, Kao WL, Rivadeneira F, Boerwinkle E, Levy D, Hofman A, Astor BC, Benjamin EJ, van Duijn CM, Witteman JC, Coresh J, Fox CS: Association of three genetic loci with uric acid concentration and risk of gout: a genome-wide association study. Lancet. 2008 Dec 6;372(9654):1953-61. doi: 10.1016/S0140-6736(08)61343-4. Epub 2008 Oct 1. [PubMed:18834626]
  17. Woodward OM, Kottgen A, Coresh J, Boerwinkle E, Guggino WB, Kottgen M: Identification of a urate transporter, ABCG2, with a common functional polymorphism causing gout. Proc Natl Acad Sci U S A. 2009 Jun 23;106(25):10338-42. doi: 10.1073/pnas.0901249106. Epub 2009 Jun 8. [PubMed:19506252]
  18. Matsuo H, Takada T, Ichida K, Nakamura T, Nakayama A, Ikebuchi Y, Ito K, Kusanagi Y, Chiba T, Tadokoro S, Takada Y, Oikawa Y, Inoue H, Suzuki K, Okada R, Nishiyama J, Domoto H, Watanabe S, Fujita M, Morimoto Y, Naito M, Nishio K, Hishida A, Wakai K, Asai Y, Niwa K, Kamakura K, Nonoyama S, Sakurai Y, Hosoya T, Kanai Y, Suzuki H, Hamajima N, Shinomiya N: Common defects of ABCG2, a high-capacity urate exporter, cause gout: a function-based genetic analysis in a Japanese population. Sci Transl Med. 2009 Nov 4;1(5):5ra11. doi: 10.1126/scitranslmed.3000237. [PubMed:20368174]
  19. Desuzinges-Mandon E, Arnaud O, Martinez L, Huche F, Di Pietro A, Falson P: ABCG2 transports and transfers heme to albumin through its large extracellular loop. J Biol Chem. 2010 Oct 22;285(43):33123-33. doi: 10.1074/jbc.M110.139170. Epub 2010 Aug 12. [PubMed:20705604]
  20. Nakayama A, Matsuo H, Takada T, Ichida K, Nakamura T, Ikebuchi Y, Ito K, Hosoya T, Kanai Y, Suzuki H, Shinomiya N: ABCG2 is a high-capacity urate transporter and its genetic impairment increases serum uric acid levels in humans. Nucleosides Nucleotides Nucleic Acids. 2011 Dec;30(12):1091-7. doi: 10.1080/15257770.2011.633953. [PubMed:22132962]
  21. Mo W, Zhang JT: Human ABCG2: structure, function, and its role in multidrug resistance. Int J Biochem Mol Biol. 2012;3(1):1-27. Epub 2011 Mar 30. [PubMed:22509477]
  22. Zelinski T, Coghlan G, Liu XQ, Reid ME: ABCG2 null alleles define the Jr(a-) blood group phenotype. Nat Genet. 2012 Jan 15;44(2):131-2. doi: 10.1038/ng.1075. [PubMed:22246507]
  23. Saison C, Helias V, Ballif BA, Peyrard T, Puy H, Miyazaki T, Perrot S, Vayssier-Taussat M, Waldner M, Le Pennec PY, Cartron JP, Arnaud L: Null alleles of ABCG2 encoding the breast cancer resistance protein define the new blood group system Junior. Nat Genet. 2012 Jan 15;44(2):174-7. doi: 10.1038/ng.1070. [PubMed:22246505]
  24. Kobuchi H, Moriya K, Ogino T, Fujita H, Inoue K, Shuin T, Yasuda T, Utsumi K, Utsumi T: Mitochondrial localization of ABC transporter ABCG2 and its function in 5-aminolevulinic acid-mediated protoporphyrin IX accumulation. PLoS One. 2012;7(11):e50082. doi: 10.1371/journal.pone.0050082. Epub 2012 Nov 26. [PubMed:23189181]
  25. Iida A, Saito S, Sekine A, Mishima C, Kitamura Y, Kondo K, Harigae S, Osawa S, Nakamura Y: Catalog of 605 single-nucleotide polymorphisms (SNPs) among 13 genes encoding human ATP-binding cassette transporters: ABCA4, ABCA7, ABCA8, ABCD1, ABCD3, ABCD4, ABCE1, ABCF1, ABCG1, ABCG2, ABCG4, ABCG5, and ABCG8. J Hum Genet. 2002;47(6):285-310. [PubMed:12111378]
  26. Itoda M, Saito Y, Shirao K, Minami H, Ohtsu A, Yoshida T, Saijo N, Suzuki H, Sugiyama Y, Ozawa S, Sawada J: Eight novel single nucleotide polymorphisms in ABCG2/BCRP in Japanese cancer patients administered irinotacan. Drug Metab Pharmacokinet. 2003;18(3):212-7. [PubMed:15618737]
  27. Zamber CP, Lamba JK, Yasuda K, Farnum J, Thummel K, Schuetz JD, Schuetz EG: Natural allelic variants of breast cancer resistance protein (BCRP) and their relationship to BCRP expression in human intestine. Pharmacogenetics. 2003 Jan;13(1):19-28. [PubMed:12544509]
  28. Morisaki K, Robey RW, Ozvegy-Laczka C, Honjo Y, Polgar O, Steadman K, Sarkadi B, Bates SE: Single nucleotide polymorphisms modify the transporter activity of ABCG2. Cancer Chemother Pharmacol. 2005 Aug;56(2):161-72. Epub 2005 Apr 19. [PubMed:15838659]
  29. Maekawa K, Itoda M, Sai K, Saito Y, Kaniwa N, Shirao K, Hamaguchi T, Kunitoh H, Yamamoto N, Tamura T, Minami H, Kubota K, Ohtsu A, Yoshida T, Saijo N, Kamatani N, Ozawa S, Sawada J: Genetic variation and haplotype structure of the ABC transporter gene ABCG2 in a Japanese population. Drug Metab Pharmacokinet. 2006 Apr;21(2):109-21. [PubMed:16702730]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04851BiricodarinvestigationalunknownDetails
DB00317Gefitinibapproved, investigationalunknownsubstrateinhibitorDetails
DB04216Quercetinexperimental, investigationalunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB03467NaringeninexperimentalunknowninhibitorDetails
DB01030Topotecanapproved, investigationalunknownsubstrateDetails
DB01051Novobiocinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00655EstroneapprovedunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB01094HesperetinexperimentalunknowninhibitorDetails
DB01645GenisteininvestigationalunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB01016GlyburideapprovedunknownsubstrateDetails
DB00255Diethylstilbestrolapproved, investigationalunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorDetails
DB00175PravastatinapprovednosubstrateDetails
DB00997Doxorubicinapproved, investigationalunknownsubstrateDetails
DB00213PantoprazoleapprovedunknownsubstrateinhibitorDetails
DB00091Ciclosporinapproved, investigational, vet_approvedunknowninhibitorDetails
DB04348Taurocholic AcidexperimentalunknowninhibitorDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00741Hydrocortisoneapproved, vet_approvedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorinducerDetails
DB01204Mitoxantroneapproved, investigationalunknownsubstrateDetails
DB02115DaidzinexperimentalunknowninhibitorDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB01268Sunitinibapproved, investigationalunknowninhibitorDetails
DB00470Dronabinolapproved, illicitunknowninhibitorDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknowninhibitorDetails
DB00795SulfasalazineapprovedunknownsubstrateinhibitorDetails
DB00966Telmisartanapproved, investigationalunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninhibitorDetails
DB01254Dasatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00457PrazosinapprovedunknownsubstrateDetails
DB00448Lansoprazoleapproved, investigationalunknowninhibitorDetails
DB01129Rabeprazoleapproved, investigationalunknowninhibitorDetails
DB04881ElacridarinvestigationalunknowninhibitorDetails
DB04868Nilotinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00530Erlotinibapproved, investigationalunknowninhibitorDetails
DB05294VandetanibapprovedunknowninhibitorDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB00773EtoposideapprovedunknownsubstrateDetails
DB00970Dactinomycinapproved, investigationalunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB00675TamoxifenapprovedunknownsubstrateDetails
DB00669Sumatriptanapproved, investigationalunknownsubstrateDetails
DB00694DaunorubicinapprovedunknownsubstrateDetails
DB04540Cholesterolapproved, investigationalunknowninducerDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB00158Folic Acidapproved, nutraceutical, vet_approvedunknownsubstrateDetails
DB03496Alvocidibexperimental, investigationalunknownsubstrateDetails
DB00541Vincristineapproved, investigationalunknownsubstrateDetails
DB00444TeniposideapprovedunknownsubstrateDetails
DB00698Nitrofurantoinapproved, vet_approvedunknownsubstrateDetails
DB00602Ivermectinapproved, investigational, vet_approvedunknownsubstrateDetails
DB04690CamptothecinexperimentalunknownsubstrateDetails
DB00740Riluzoleapproved, investigationalunknownsubstrateDetails
DB00242Cladribineapproved, investigationalunknownsubstrateDetails
DB00631Clofarabineapproved, investigationalunknownsubstrateDetails
DB00526Oxaliplatinapproved, investigationalunknownsubstrateDetails
DB06772CabazitaxelapprovedunknowninhibitorDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB06589PazopanibapprovedunknownsubstrateDetails
DB08864RilpivirineapprovedunknowninhibitorDetails
DB08880TeriflunomideapprovedunknownsubstrateinhibitorDetails
DB01097Leflunomideapproved, investigationalunknownsubstrateDetails
DB08881VemurafenibapprovedunknownsubstrateinhibitorDetails
DB06605ApixabanapprovedunknownsubstrateDetails
DB08828Vismodegibapproved, investigationalunknowninhibitorDetails
DB08896RegorafenibapprovedunknowninhibitorDetails
DB08901Ponatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB08912Dabrafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB00549Zafirlukastapproved, investigationalunknownantagonistDetails
DB00285VenlafaxineapprovedunknowninducerDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB08916AfatinibapprovedunknownsubstrateinhibitorDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB00515CisplatinapprovedunknownsubstrateDetails
DB00958CarboplatinapprovedunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB08934SofosbuvirapprovednosubstrateDetails
DB09078Lenvatinibapproved, investigationalnosubstrateDetails
DB09054IdelalisibapprovednosubstrateDetails
DB09065CobicistatapprovedyesinhibitorDetails
DB09291Rolapitantapproved, investigationalnoinhibitorDetails
DB09102Daclatasvirapproved, investigationalunknowninhibitorDetails
DB05239Cobimetinibapproved, investigationalunknownweak inhibitorDetails
DB09330OsimertinibapprovednosubstrateDetails
DB11363Alectinibapproved, investigationalnoinhibitorDetails
DB08931RiociguatapprovedyessubstrateDetails
DB09183DasabuvirapprovedunknowninhibitorDetails
DB06654Safinamideapproved, investigationalunknowninhibitorDetails
DB11613Velpatasvirapproved, investigationalnosubstrateinhibitorDetails
DB06290SimeprevirapprovedunknownsubstrateinhibitorDetails
DB09027LedipasvirapprovednotransporterDetails
DB09296Ombitasvirapproved, investigationalnosubstrateDetails
DB11943Delafloxacinapproved, investigationalnosubstrateDetails
DB01685TopiroxostatexperimentalunknowninhibitorDetails
DB12026Voxilaprevirapproved, investigationalnosubstrateinhibitorDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorDetails
DB13878Pibrentasvirapproved, investigationalunknownsubstrateinhibitorDetails
DB13879Glecaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB12483Copanlisibapproved, investigationalunknownsubstrateDetails
DB12001Abemaciclibapproved, investigationalunknownsubstrateinhibitorDetails
DB12070Letermovirapproved, investigationalnoinhibitorDetails
DB12267Brigatinibapproved, investigationalnosubstrateinhibitorDetails
DB08930DolutegravirapprovednosubstrateDetails
DB12332Rucaparibapproved, investigationalunknownsubstrateinhibitorDetails
DB11817Baricitinibapproved, investigationalunknownsubstrateinhibitorDetails
DB09061Cannabidiolapproved, investigationalunknowninhibitorDetails
DB11827Ertugliflozinapproved, investigationalunknownsubstrateDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails
DB11901Apalutamideapproved, investigationalunknowninducerDetails
DB11633Isavuconazoleapproved, investigationalunknowninhibitorDetails
DB14011NabiximolsinvestigationalunknowninhibitorDetails
DB14009Medical Cannabisexperimental, investigationalunknowninhibitorDetails
DB12010Fostamatinibapproved, investigationalnoinhibitorDetails
DB11995Avatrombopagapproved, investigationalunknowninhibitorDetails
DB09297Paritaprevirapproved, investigationalunknowninhibitorDetails
DB11431Moxidectininvestigational, vet_approvednosubstrateDetails
DB00482Celecoxibapproved, investigationalunknownDetails
DB14538Hydrocortisone aceponateexperimental, vet_approvedunknownDetails
DB14539Hydrocortisone acetateapproved, vet_approvedunknownDetails
DB14540Hydrocortisone butyrateapproved, vet_approvedunknownDetails
DB14541Hydrocortisone cypionateapproved, investigational, vet_approvedunknownDetails
DB14542Hydrocortisone phosphateapproved, vet_approvedunknownDetails
DB14543Hydrocortisone probutateapproved, vet_approvedunknownDetails
DB14544Hydrocortisone valerateapproved, vet_approvedunknownDetails
DB05928DovitinibinvestigationalunknowninhibitorinducerDetails
DB13125Lusutrombopagapproved, investigationalunknownsubstrateDetails
DB06210EltrombopagapprovedunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorinducerDetails
DB02703Fusidic Acidapproved, investigationalunknowninhibitorDetails
DB11952Duvelisibapproved, investigationalnosubstrateDetails
DB11760Talazoparibapproved, investigationalunknownsubstrateDetails
DB11963Dacomitinibapproved, investigationalnosubstrateinhibitorDetails
DB11581Venetoclaxapproved, investigationalunknowninhibitorDetails
DB11855Revefenacinapproved, investigationalnosubstrateDetails
DB12141Gilteritinibapproved, investigationalnoinhibitorDetails
DB06228RivaroxabanapprovedunknownsubstrateDetails
DB09279FimasartaninvestigationalunknownsubstrateDetails
DB11978Glasdegibapproved, investigationalnosubstrateinhibitorDetails
DB09074OlaparibapprovednoinhibitorDetails
DB00437AllopurinolapprovedunknownsubstrateDetails
DB09073Palbociclibapproved, investigationalnosubstrateinhibitorDetails
DB08907CanagliflozinapprovedunknownDetails
DB01079Tegaserodapproved, investigational, withdrawnunknownsubstrateDetails
DB09299Tenofovir alafenamideapprovednosubstrateDetails
DB00481Raloxifeneapproved, investigationalunknownsubstrateDetails