Solute carrier organic anion transporter family member 1B1

Details

Name
Solute carrier organic anion transporter family member 1B1
Synonyms
  • Liver-specific organic anion transporter 1
  • LST-1
  • LST1
  • OATP-2
  • OATP-C
  • OATP1B1
  • OATP2
  • OATPC
  • SLC21A6
  • Sodium-independent organic anion-transporting polypeptide 2
  • Solute carrier family 21 member 6
Gene Name
SLCO1B1
Organism
Human
Amino acid sequence
>lcl|BSEQ0010701|Solute carrier organic anion transporter family member 1B1
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
Number of residues
691
Molecular Weight
76447.99
Theoretical pI
8.68
GO Classification
Functions
sodium-independent organic anion transmembrane transporter activity / bile acid transmembrane transporter activity
Processes
organic anion transport / small molecule metabolic process / anion transmembrane transport / transmembrane transport / bile acid metabolic process / bile acid and bile salt transport / sodium-independent organic anion transport
Components
membrane / plasma membrane / integral component of plasma membrane / basolateral plasma membrane
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Mediates the Na(+)-independent uptake of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, 17-beta-glucuronosyl estradiol, estrone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, leukotriene E4, thyroxine and triiodothyronine. Involved in the clearance of bile acids and organic anions from the liver.
Pfam Domain Function
Transmembrane Regions
29-48 68-88 95-119 169-197 217-237 256-280 332-353 374-397 402-425 538-560 570-595 630-647
Cellular Location
Basolateral cell membrane
Gene sequence
>lcl|BSEQ0010702|Solute carrier organic anion transporter family member 1B1 (SLCO1B1)
ATGGACCAAAATCAACATTTGAATAAAACAGCAGAGGCACAACCTTCAGAGAATAAGAAA
ACAAGATACTGCAATGGATTGAAGATGTTCTTGGCAGCTCTGTCACTCAGCTTTATTGCT
AAGACACTAGGTGCAATTATTATGAAAAGTTCCATCATTCATATAGAACGGAGATTTGAG
ATATCCTCTTCTCTTGTTGGTTTTATTGACGGAAGCTTTGAAATTGGAAATTTGCTTGTG
ATTGTATTTGTGAGTTACTTTGGATCCAAACTACATAGACCAAAGTTAATTGGAATCGGT
TGTTTCATTATGGGAATTGGAGGTGTTTTGACTGCTTTGCCACATTTCTTCATGGGATAT
TACAGGTATTCTAAAGAAACTAATATCAATTCATCAGAAAATTCAACATCGACCTTATCC
ACTTGTTTAATTAATCAAATTTTATCACTCAATAGAGCATCACCTGAGATAGTGGGAAAA
GGTTGTTTAAAGGAATCTGGGTCATACATGTGGATATATGTGTTCATGGGTAATATGCTT
CGTGGAATAGGGGAGACTCCCATAGTACCATTGGGGCTTTCTTACATTGATGATTTCGCT
AAAGAAGGACATTCTTCTTTGTATTTAGGTATATTGAATGCAATAGCAATGATTGGTCCA
ATCATTGGCTTTACCCTGGGATCTCTGTTTTCTAAAATGTACGTGGATATTGGATATGTA
GATCTAAGCACTATCAGGATAACTCCTACTGATTCTCGATGGGTTGGAGCTTGGTGGCTT
AATTTCCTTGTGTCTGGACTATTCTCCATTATTTCTTCCATACCATTCTTTTTCTTGCCC
CAAACTCCAAATAAACCACAAAAAGAAAGAAAAGCTTCACTGTCTTTGCATGTGCTGGAA
ACAAATGATGAAAAGGATCAAACAGCTAATTTGACCAATCAAGGAAAAAATATTACCAAA
AATGTGACTGGTTTTTTCCAGTCTTTTAAAAGCATCCTTACTAATCCCCTGTATGTTATG
TTTGTGCTTTTGACGTTGTTACAAGTAAGCAGCTATATTGGTGCTTTTACTTATGTCTTC
AAATACGTAGAGCAACAGTATGGTCAGCCTTCATCTAAGGCTAACATCTTATTGGGAGTC
ATAACCATACCTATTTTTGCAAGTGGAATGTTTTTAGGAGGATATATCATTAAAAAATTC
AAACTGAACACCGTTGGAATTGCCAAATTCTCATGTTTTACTGCTGTGATGTCATTGTCC
TTTTACCTATTATATTTTTTCATACTCTGTGAAAACAAATCAGTTGCCGGACTAACCATG
ACCTATGATGGAAATAATCCAGTGACATCTCATAGAGATGTACCACTTTCTTATTGCAAC
TCAGACTGCAATTGTGATGAAAGTCAATGGGAACCAGTCTGTGGAAACAATGGAATAACT
TACATCTCACCCTGTCTAGCAGGTTGCAAATCTTCAAGTGGCAATAAAAAGCCTATAGTG
TTTTACAACTGCAGTTGTTTGGAAGTAACTGGTCTCCAGAACAGAAATTACTCAGCCCAT
TTGGGTGAATGCCCAAGAGATGATGCTTGTACAAGGAAATTTTACTTTTTTGTTGCAATA
CAAGTCTTGAATTTATTTTTCTCTGCACTTGGAGGCACCTCACATGTCATGCTGATTGTT
AAAATTGTTCAACCTGAATTGAAATCACTTGCACTGGGTTTCCACTCAATGGTTATACGA
GCACTAGGAGGAATTCTAGCTCCAATATATTTTGGGGCTCTGATTGATACAACGTGTATA
AAGTGGTCCACCAACAACTGTGGCACACGTGGGTCATGTAGGACATATAATTCCACATCA
TTTTCAAGGGTCTACTTGGGCTTGTCTTCAATGTTAAGAGTCTCATCACTTGTTTTATAT
ATTATATTAATTTATGCCATGAAGAAAAAATATCAAGAGAAAGATATCAATGCATCAGAA
AATGGAAGTGTCATGGATGAAGCAAACTTAGAATCCTTAAATAAAAATAAACATTTTGTC
CCTTCTGCTGGGGCAGATAGTGAAACACATTGTTAA
Chromosome Location
12
Locus
12p
External Identifiers
ResourceLink
UniProtKB IDQ9Y6L6
UniProtKB Entry NameSO1B1_HUMAN
GenBank Protein ID5051630
GenBank Gene IDAF060500
GenAtlas IDSLCO1B1
HGNC IDHGNC:10959
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateinhibitorinducerDetails
DB02659Cholic AcidapprovedunknownsubstrateinhibitorinducerDetails
DB00199Erythromycinapproved, investigational, vet_approvednosubstrateinhibitorDetails
DB01045RifampicinapprovedunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknownsubstrateinhibitorDetails
DB00655EstroneapprovedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00224IndinavirapprovedunknowninhibitorDetails
DB01892HyperforinnutraceuticalunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB00583L-Carnitineapproved, investigationalunknowninhibitorDetails
DB00877Sirolimusapproved, investigationalunknowninhibitorDetails
DB00641SimvastatinapprovedunknownsubstrateinhibitorDetails
DB00227Lovastatinapproved, investigationalunknownsubstrateinhibitorDetails
DB01076AtorvastatinapprovedunknownsubstrateinhibitorDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninhibitorDetails
DB00412Rosiglitazoneapproved, investigationalunknowninhibitorDetails
DB01132Pioglitazoneapproved, investigationalunknowninhibitorDetails
DB00762Irinotecanapproved, investigationalunknowninhibitorDetails
DB00520CaspofunginapprovedunknowninhibitorDetails
DB00175PravastatinapprovedunknownsubstrateinhibitorDetails
DB01393Bezafibrateapproved, investigationalunknowninhibitorDetails
DB01241GemfibrozilapprovedunknowninhibitorDetails
DB06151Acetylcysteineapproved, investigationalunknowninhibitorDetails
DB04881ElacridarinvestigationalunknowninhibitorDetails
DB06191ZosuquidarinvestigationalunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00213PantoprazoleapprovedunknowninhibitorDetails
DB00917DinoprostoneapprovedunknownsubstrateDetails
DB01053Benzylpenicillinapproved, vet_approvedunknownsubstrateDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB00279Liothyronineapproved, vet_approvedunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateinhibitorDetails
DB00275Olmesartanapproved, investigationalunknownsubstrateDetails
DB00669Sumatriptanapproved, investigationalunknownsubstrateDetails
DB01092OuabainapprovedunknownsubstrateinhibitorDetails
DB00390DigoxinapprovedunknownsubstrateinhibitorDetails
DB00859PenicillamineapprovedunknownsubstrateDetails
DB00177Valsartanapproved, investigationalunknownsubstrateinhibitorDetails
DB06721GimatecaninvestigationalunknownsubstrateDetails
DB01583LiotrixapprovedunknownsubstrateDetails
DB06210EltrombopagapprovedunknowninhibitorDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB02691Glycocholic acidexperimental, investigationalunknownDetails
DB05804Prasterone sulfateinvestigationalunknownDetails
DB00451LevothyroxineapprovedunknowninhibitorDetails
DB00509Dextrothyroxineapproved, investigationalunknownDetails
DB00950Fexofenadineapproved, investigationalunknownDetails
DB08855Leukotriene C4experimental, investigationalunknownDetails
DB08856DADLEexperimentalunknownDetails
DB01095FluvastatinapprovedunknownsubstrateinhibitorDetails
DB08860PitavastatinapprovedunknownsubstrateinhibitorDetails
DB06589PazopanibapprovedunknowninhibitorDetails
DB06772CabazitaxelapprovedunknowninhibitorDetails
DB08864RilpivirineapprovedunknowninhibitorDetails
DB08884Gadoxetic acidapprovedunknownsubstrateDetails
DB06626Axitinibapproved, investigationalnosubstrateinhibitorDetails
DB08912Dabrafenibapproved, investigationalunknowninhibitorDetails
DB00912Repaglinideapproved, investigationalunknownsubstrateDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateinhibitorDetails
DB06290SimeprevirapprovedunknownsubstrateinhibitorDetails
DB04850PosizolidinvestigationalunknowninhibitorDetails
DB01045RifampicinapprovedunknownDetails
DB01211ClarithromycinapprovedunknownDetails
DB09054IdelalisibapprovednoinhibitorDetails
DB09272Eluxadolineapproved, investigationalunknownsubstrateinhibitorDetails
DB09292SacubitrilapprovedunknowninhibitorDetails
DB09102Daclatasvirapproved, investigationalunknowninhibitorDetails
DB05239Cobimetinibapproved, investigationalunknownsubstrateweak inhibitorDetails
DB11362SelexipagapprovednosubstrateDetails
DB06403Ambrisentanapproved, investigationalunknownsubstrateDetails
DB11575GrazoprevirapprovednosubstrateDetails
DB09137Technetium Tc-99m mebrofeninapprovedyessubstrateDetails
DB13139Levosalbutamolapproved, investigationalunknownsubstrateDetails
DB13153Levomenolapproved, experimentalunknownsubstrateDetails
DB11613Velpatasvirapproved, investigationalnoinhibitortransporterDetails
DB05521Telaprevirapproved, withdrawnunknowninhibitorDetails
DB09198LobeglitazoneexperimentalnoinhibitorDetails
DB12026Voxilaprevirapproved, investigationalnosubstrateinhibitorDetails
DB13874Enasidenibapproved, investigationalunknowninhibitorDetails
DB13878Pibrentasvirapproved, investigationalunknowninhibitorDetails
DB13879Glecaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB12070Letermovirapproved, investigationalnosubstrateDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB13928Semaglutideapproved, investigationalnoinhibitorDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails
DB11901Apalutamideapproved, investigationalunknowninducerDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateinhibitorDetails
DB09297Paritaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB00975DipyridamoleapprovedunknowninhibitorDetails
DB01072Atazanavirapproved, investigationalunknowninhibitorDetails
DB00541Vincristineapproved, investigationalunknowninhibitorDetails
DB12319Benzbromaroneinvestigational, withdrawnunknowninhibitorDetails
DB08862Cholecystokininapproved, investigationalunknownsubstrateinhibitorDetails
DB00255Diethylstilbestrolapproved, investigationalunknowninhibitorDetails
DB01645GenisteininvestigationalunknowninhibitorDetails
DB00602Ivermectinapproved, investigational, vet_approvedunknowninhibitorDetails
DB01115NifedipineapprovedunknowninhibitorDetails
DB01051Novobiocinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00646Nystatinapproved, vet_approvedunknowninhibitorDetails
DB11869ValspodarinvestigationalunknowninhibitorDetails
DB00206Reserpineapproved, investigationalunknowninhibitorDetails
DB09298Silibinin Aexperimental, investigationalunknowninhibitorDetails
DB00795SulfasalazineapprovedunknowninhibitorDetails
DB00932Tipranavirapproved, investigationalunknowninhibitorDetails
DB01601LopinavirapprovedunknowninhibitorDetails
DB01264DarunavirapprovedunknowninhibitorDetails
DB00328Indomethacinapproved, investigationalunknowninhibitorDetails
DB00701Amprenavirapproved, investigationalunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB04216Quercetinexperimental, investigationalunknowninhibitorDetails
DB00622Nicardipineapproved, investigationalunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB00570VinblastineapprovedunknowninhibitorDetails
DB00468QuinineapprovedunknowninhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB13919CandesartanexperimentalunknowninhibitorDetails
DB09065CobicistatapprovedunknowninhibitorDetails
DB00976TelithromycinapprovedunknowninhibitorDetails
DB01590EverolimusapprovedunknowninhibitorDetails
DB00203Sildenafilapproved, investigationalunknowninhibitorDetails
DB00864Tacrolimusapproved, investigationalunknowninhibitorDetails
DB00398Sorafenibapproved, investigationalunknowninhibitorDetails
DB04868Nilotinibapproved, investigationalunknowninhibitorDetails
DB11586Asunaprevirapproved, investigational, withdrawnunknowninhibitorDetails
DB11979Elagolixapproved, investigationalunknownsubstrateDetails
DB13867Fluticasoneapproved, experimentalnoinhibitorDetails
DB08906Fluticasone furoateapprovednoinhibitorDetails
DB00588Fluticasone propionateapprovednoinhibitorDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB05928DovitinibinvestigationalunknowninhibitorDetails
DB08880TeriflunomideapprovedunknowninhibitorDetails
DB02703Fusidic Acidapproved, investigationalunknownDetails