Solute carrier organic anion transporter family member 1B1

Details

Name
Solute carrier organic anion transporter family member 1B1
Synonyms
  • Liver-specific organic anion transporter 1
  • LST-1
  • LST1
  • OATP-2
  • OATP-C
  • OATP1B1
  • OATP2
  • OATPC
  • SLC21A6
  • Sodium-independent organic anion-transporting polypeptide 2
  • Solute carrier family 21 member 6
Gene Name
SLCO1B1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010701|Solute carrier organic anion transporter family member 1B1
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
Number of residues
691
Molecular Weight
76447.99
Theoretical pI
8.68
GO Classification
Functions
bile acid transmembrane transporter activity / sodium-independent organic anion transmembrane transporter activity
Processes
anion transmembrane transport / bile acid and bile salt transport / bile acid metabolic process / organic anion transport / small molecule metabolic process / sodium-independent organic anion transport / transmembrane transport
Components
basolateral plasma membrane / integral component of plasma membrane / membrane / plasma membrane
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Mediates the Na(+)-independent uptake of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, 17-beta-glucuronosyl estradiol, estrone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, leukotriene E4, thyroxine and triiodothyronine. Involved in the clearance of bile acids and organic anions from the liver.
Pfam Domain Function
Transmembrane Regions
29-48 68-88 95-119 169-197 217-237 256-280 332-353 374-397 402-425 538-560 570-595 630-647
Cellular Location
Basolateral cell membrane
Gene sequence
>lcl|BSEQ0010702|Solute carrier organic anion transporter family member 1B1 (SLCO1B1)
ATGGACCAAAATCAACATTTGAATAAAACAGCAGAGGCACAACCTTCAGAGAATAAGAAA
ACAAGATACTGCAATGGATTGAAGATGTTCTTGGCAGCTCTGTCACTCAGCTTTATTGCT
AAGACACTAGGTGCAATTATTATGAAAAGTTCCATCATTCATATAGAACGGAGATTTGAG
ATATCCTCTTCTCTTGTTGGTTTTATTGACGGAAGCTTTGAAATTGGAAATTTGCTTGTG
ATTGTATTTGTGAGTTACTTTGGATCCAAACTACATAGACCAAAGTTAATTGGAATCGGT
TGTTTCATTATGGGAATTGGAGGTGTTTTGACTGCTTTGCCACATTTCTTCATGGGATAT
TACAGGTATTCTAAAGAAACTAATATCAATTCATCAGAAAATTCAACATCGACCTTATCC
ACTTGTTTAATTAATCAAATTTTATCACTCAATAGAGCATCACCTGAGATAGTGGGAAAA
GGTTGTTTAAAGGAATCTGGGTCATACATGTGGATATATGTGTTCATGGGTAATATGCTT
CGTGGAATAGGGGAGACTCCCATAGTACCATTGGGGCTTTCTTACATTGATGATTTCGCT
AAAGAAGGACATTCTTCTTTGTATTTAGGTATATTGAATGCAATAGCAATGATTGGTCCA
ATCATTGGCTTTACCCTGGGATCTCTGTTTTCTAAAATGTACGTGGATATTGGATATGTA
GATCTAAGCACTATCAGGATAACTCCTACTGATTCTCGATGGGTTGGAGCTTGGTGGCTT
AATTTCCTTGTGTCTGGACTATTCTCCATTATTTCTTCCATACCATTCTTTTTCTTGCCC
CAAACTCCAAATAAACCACAAAAAGAAAGAAAAGCTTCACTGTCTTTGCATGTGCTGGAA
ACAAATGATGAAAAGGATCAAACAGCTAATTTGACCAATCAAGGAAAAAATATTACCAAA
AATGTGACTGGTTTTTTCCAGTCTTTTAAAAGCATCCTTACTAATCCCCTGTATGTTATG
TTTGTGCTTTTGACGTTGTTACAAGTAAGCAGCTATATTGGTGCTTTTACTTATGTCTTC
AAATACGTAGAGCAACAGTATGGTCAGCCTTCATCTAAGGCTAACATCTTATTGGGAGTC
ATAACCATACCTATTTTTGCAAGTGGAATGTTTTTAGGAGGATATATCATTAAAAAATTC
AAACTGAACACCGTTGGAATTGCCAAATTCTCATGTTTTACTGCTGTGATGTCATTGTCC
TTTTACCTATTATATTTTTTCATACTCTGTGAAAACAAATCAGTTGCCGGACTAACCATG
ACCTATGATGGAAATAATCCAGTGACATCTCATAGAGATGTACCACTTTCTTATTGCAAC
TCAGACTGCAATTGTGATGAAAGTCAATGGGAACCAGTCTGTGGAAACAATGGAATAACT
TACATCTCACCCTGTCTAGCAGGTTGCAAATCTTCAAGTGGCAATAAAAAGCCTATAGTG
TTTTACAACTGCAGTTGTTTGGAAGTAACTGGTCTCCAGAACAGAAATTACTCAGCCCAT
TTGGGTGAATGCCCAAGAGATGATGCTTGTACAAGGAAATTTTACTTTTTTGTTGCAATA
CAAGTCTTGAATTTATTTTTCTCTGCACTTGGAGGCACCTCACATGTCATGCTGATTGTT
AAAATTGTTCAACCTGAATTGAAATCACTTGCACTGGGTTTCCACTCAATGGTTATACGA
GCACTAGGAGGAATTCTAGCTCCAATATATTTTGGGGCTCTGATTGATACAACGTGTATA
AAGTGGTCCACCAACAACTGTGGCACACGTGGGTCATGTAGGACATATAATTCCACATCA
TTTTCAAGGGTCTACTTGGGCTTGTCTTCAATGTTAAGAGTCTCATCACTTGTTTTATAT
ATTATATTAATTTATGCCATGAAGAAAAAATATCAAGAGAAAGATATCAATGCATCAGAA
AATGGAAGTGTCATGGATGAAGCAAACTTAGAATCCTTAAATAAAAATAAACATTTTGTC
CCTTCTGCTGGGGCAGATAGTGAAACACATTGTTAA
Chromosome Location
12
Locus
12p
External Identifiers
ResourceLink
UniProtKB IDQ9Y6L6
UniProtKB Entry NameSO1B1_HUMAN
GenBank Protein ID5051630
GenBank Gene IDAF060500
GenAtlas IDSLCO1B1
HGNC IDHGNC:10959
General References
  1. Abe T, Kakyo M, Tokui T, Nakagomi R, Nishio T, Nakai D, Nomura H, Unno M, Suzuki M, Naitoh T, Matsuno S, Yawo H: Identification of a novel gene family encoding human liver-specific organic anion transporter LST-1. J Biol Chem. 1999 Jun 11;274(24):17159-63. [PubMed:10358072]
  2. Hsiang B, Zhu Y, Wang Z, Wu Y, Sasseville V, Yang WP, Kirchgessner TG: A novel human hepatic organic anion transporting polypeptide (OATP2). Identification of a liver-specific human organic anion transporting polypeptide and identification of rat and human hydroxymethylglutaryl-CoA reductase inhibitor transporters. J Biol Chem. 1999 Dec 24;274(52):37161-8. [PubMed:10601278]
  3. Konig J, Cui Y, Nies AT, Keppler D: A novel human organic anion transporting polypeptide localized to the basolateral hepatocyte membrane. Am J Physiol Gastrointest Liver Physiol. 2000 Jan;278(1):G156-64. [PubMed:10644574]
  4. Konig J, Cui Y, Nies AT, Keppler D: Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide. J Biol Chem. 2000 Jul 28;275(30):23161-8. [PubMed:10779507]
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. van de Steeg E, Stranecky V, Hartmannova H, Noskova L, Hrebicek M, Wagenaar E, van Esch A, de Waart DR, Oude Elferink RP, Kenworthy KE, Sticova E, al-Edreesi M, Knisely AS, Kmoch S, Jirsa M, Schinkel AH: Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome by interrupting conjugated bilirubin reuptake into the liver. J Clin Invest. 2012 Feb;122(2):519-28. doi: 10.1172/JCI59526. Epub 2012 Jan 9. [PubMed:22232210]
  8. Yao J, Hong W, Huang J, Zhan K, Huang H, Hong M: N-Glycosylation dictates proper processing of organic anion transporting polypeptide 1B1. PLoS One. 2012;7(12):e52563. doi: 10.1371/journal.pone.0052563. Epub 2012 Dec 20. [PubMed:23285087]
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  10. Tirona RG, Leake BF, Merino G, Kim RB: Polymorphisms in OATP-C: identification of multiple allelic variants associated with altered transport activity among European- and African-Americans. J Biol Chem. 2001 Sep 21;276(38):35669-75. Epub 2001 Jul 26. [PubMed:11477075]
  11. Michalski C, Cui Y, Nies AT, Nuessler AK, Neuhaus P, Zanger UM, Klein K, Eichelbaum M, Keppler D, Konig J: A naturally occurring mutation in the SLC21A6 gene causing impaired membrane localization of the hepatocyte uptake transporter. J Biol Chem. 2002 Nov 8;277(45):43058-63. Epub 2002 Aug 23. [PubMed:12196548]
  12. Nozawa T, Nakajima M, Tamai I, Noda K, Nezu J, Sai Y, Tsuji A, Yokoi T: Genetic polymorphisms of human organic anion transporters OATP-C (SLC21A6) and OATP-B (SLC21A9): allele frequencies in the Japanese population and functional analysis. J Pharmacol Exp Ther. 2002 Aug;302(2):804-13. [PubMed:12130747]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04348Taurocholic acidapproved, experimentalunknownsubstrateinhibitorinducerDetails
DB02659Cholic AcidapprovedunknownsubstrateinhibitorinducerDetails
DB00199Erythromycinapproved, investigational, vet_approvednosubstrateinhibitorDetails
DB01045RifampicinapprovedunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknownsubstrateinhibitorDetails
DB00655EstroneapprovedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00224IndinavirapprovedunknowninhibitorDetails
DB01892HyperforinnutraceuticalunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB00583Levocarnitineapproved, investigationalunknowninhibitorDetails
DB00877Sirolimusapproved, investigationalunknowninhibitorDetails
DB00641SimvastatinapprovedunknownsubstrateinhibitorDetails
DB00227Lovastatinapproved, investigationalunknownsubstrateinhibitorDetails
DB01076AtorvastatinapprovednosubstrateinhibitorDetails
DB00197Troglitazoneapproved, investigational, withdrawnunknowninhibitorDetails
DB00412Rosiglitazoneapproved, investigationalunknowninhibitorDetails
DB01132Pioglitazoneapproved, investigationalunknowninhibitorDetails
DB00762Irinotecanapproved, investigationalunknowninhibitorDetails
DB00520CaspofunginapprovedunknowninhibitorDetails
DB00175PravastatinapprovednosubstrateDetails
DB01393Bezafibrateapproved, investigationalunknowninhibitorDetails
DB06151Acetylcysteineapproved, investigationalunknowninhibitorDetails
DB04881ElacridarinvestigationalunknowninhibitorDetails
DB06191ZosuquidarinvestigationalunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00917DinoprostoneapprovedunknownsubstrateDetails
DB01053Benzylpenicillinapproved, vet_approvedunknownsubstrateDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB00279Liothyronineapproved, vet_approvedunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateinhibitorDetails
DB00275Olmesartanapproved, investigationalunknownsubstrateDetails
DB00669Sumatriptanapproved, investigationalunknownsubstrateDetails
DB01092OuabainapprovedunknownsubstrateinhibitorDetails
DB00390DigoxinapprovedunknownsubstrateinhibitorDetails
DB00859PenicillamineapprovedunknownsubstrateDetails
DB00177Valsartanapproved, investigationalunknownsubstrateinhibitorDetails
DB06721GimatecaninvestigationalunknownsubstrateDetails
DB01583LiotrixapprovedunknownsubstrateDetails
DB06210EltrombopagapprovedunknowninhibitorDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB02691Glycocholic acidexperimental, investigationalunknownDetails
DB05804Prasterone sulfateinvestigationalunknownDetails
DB00451LevothyroxineapprovedunknowninhibitorDetails
DB00509Dextrothyroxineapproved, investigationalunknownDetails
DB00950Fexofenadineapproved, investigationalunknownDetails
DB08855Leukotriene C4experimental, investigationalunknownDetails
DB08856DADLEexperimentalunknownDetails
DB08857Bamet-UD2experimentalunknownDetails
DB08858cis-Diamminechlorocholylglycinateplatinum(II)experimentalunknownDetails
DB01095FluvastatinapprovedunknownsubstrateinhibitorDetails
DB08860PitavastatinapprovedunknownsubstrateinhibitorDetails
DB06589PazopanibapprovedunknowninhibitorDetails
DB06772CabazitaxelapprovedunknowninhibitorDetails
DB08864RilpivirineapprovedunknowninhibitorDetails
DB08884Gadoxetic acidapprovedunknownsubstrateDetails
DB06626Axitinibapproved, investigationalnosubstrateinhibitorDetails
DB08912Dabrafenibapproved, investigationalunknowninhibitorDetails
DB00912Repaglinideapproved, investigationalunknownsubstrateDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateinhibitorDetails
DB06290SimeprevirapprovedunknownsubstrateinhibitorDetails
DB04850PosizolidinvestigationalunknowninhibitorDetails
DB01211ClarithromycinapprovedunknownDetails
DB09054IdelalisibapprovednoinhibitorDetails
DB09272Eluxadolineapproved, investigationalunknownsubstrateinhibitorDetails
DB09292SacubitrilapprovedunknowninhibitorDetails
DB09102Daclatasvirapproved, investigationalunknowninhibitorDetails
DB05239Cobimetinibapproved, investigationalunknownsubstrateweak inhibitorDetails
DB11362SelexipagapprovednosubstrateDetails
DB06403Ambrisentanapproved, investigationalunknownsubstrateDetails
DB11575GrazoprevirapprovednosubstrateDetails
DB09137Technetium Tc-99m mebrofeninapprovedyessubstrateDetails
DB13139Levosalbutamolapproved, investigationalunknownsubstrateDetails
DB13153Levomenolapproved, experimentalunknownsubstrateDetails
DB11613Velpatasvirapproved, investigationalnoinhibitortransporterDetails
DB05521Telaprevirapproved, withdrawnunknowninhibitorDetails
DB09198LobeglitazoneexperimentalnoinhibitorDetails
DB12026Voxilaprevirapproved, investigationalnosubstrateinhibitorDetails
DB13874Enasidenibapproved, investigationalunknowninhibitorDetails
DB13878Pibrentasvirapproved, investigationalunknowninhibitorDetails
DB13879Glecaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB12070Letermovirapproved, investigationalnosubstrateDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails
DB11901Apalutamideapproved, investigationalunknowninducerDetails
DB09297Paritaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB00975DipyridamoleapprovedunknowninhibitorDetails
DB01072Atazanavirapproved, investigationalunknowninhibitorDetails
DB00541Vincristineapproved, investigationalunknowninhibitorDetails
DB12319Benzbromaroneinvestigational, withdrawnunknowninhibitorDetails
DB08862Cholecystokininapproved, investigationalunknownsubstrateinhibitorDetails
DB00255Diethylstilbestrolapproved, investigationalunknowninhibitorDetails
DB01645GenisteininvestigationalunknowninhibitorDetails
DB00602Ivermectinapproved, investigational, vet_approvedunknowninhibitorDetails
DB01115NifedipineapprovedunknowninhibitorDetails
DB01051Novobiocinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00646Nystatinapproved, vet_approvedunknowninhibitorDetails
DB11869ValspodarinvestigationalunknowninhibitorDetails
DB00206Reserpineapproved, investigationalunknowninhibitorDetails
DB09298Silibininexperimental, investigationalunknowninhibitorDetails
DB00795SulfasalazineapprovedunknowninhibitorDetails
DB00932Tipranavirapproved, investigationalunknowninhibitorDetails
DB01601LopinavirapprovedunknowninhibitorDetails
DB01264DarunavirapprovedunknowninhibitorDetails
DB00328Indomethacinapproved, investigationalunknowninhibitorDetails
DB00701Amprenavirapproved, investigationalunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB04216Quercetinexperimental, investigationalunknowninhibitorDetails
DB00622Nicardipineapproved, investigationalunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB00570VinblastineapprovedunknowninhibitorDetails
DB00468QuinineapprovedunknowninhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB13919CandesartanexperimentalunknowninhibitorDetails
DB09065CobicistatapprovedunknowninhibitorDetails
DB00976TelithromycinapprovedunknowninhibitorDetails
DB01590EverolimusapprovedunknowninhibitorDetails
DB00203Sildenafilapproved, investigationalunknowninhibitorDetails
DB00864Tacrolimusapproved, investigationalunknowninhibitorDetails
DB00398Sorafenibapproved, investigationalunknowninhibitorDetails
DB04868Nilotinibapproved, investigationalunknowninhibitorDetails
DB11586Asunaprevirapproved, investigational, withdrawnunknownsubstrateinhibitorDetails
DB11979Elagolixapproved, investigationalunknownsubstrateDetails
DB13867Fluticasoneapproved, experimentalnoinhibitorDetails
DB08906Fluticasone furoateapprovednoinhibitorDetails
DB00588Fluticasone propionateapprovednoinhibitorDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB05928DovitinibinvestigationalunknowninhibitorDetails
DB08880TeriflunomideapprovedunknowninhibitorDetails
DB02703Fusidic acidapproved, investigationalunknownDetails
DB11753Rifamycinapproved, investigationalnoinhibitorDetails
DB11581Venetoclaxapproved, investigationalunknowninhibitorDetails
DB11855Revefenacinapproved, investigationalnosubstrateDetails
DB09279FimasartaninvestigationalunknownsubstrateDetails
DB00834Mifepristoneapproved, investigationalnoinhibitorDetails
DB00257Clotrimazoleapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00214TorasemideapprovednosubstrateDetails
DB13867Fluticasoneapproved, experimentalunknowninhibitorDetails
DB08906Fluticasone furoateapprovedunknownDetails
DB09299Tenofovir alafenamideapprovednosubstrateDetails
DB00481Raloxifeneapproved, investigationalunknownsubstrateDetails
DB00394Beclomethasone dipropionateapproved, investigationalunknowninhibitorDetails
DB12978Pexidartinibapproved, investigationalunknowninhibitorDetails
DB12500Fedratinibapproved, investigationalunknowninhibitorDetails
DB11757Istradefyllineapproved, investigationalunknowninhibitorDetails
DB01241GemfibrozilapprovedunknowninhibitorDetails
DB04855DronedaroneapprovednoinhibitorDetails
DB15444Elexacaftorapproved, investigationalunknowninhibitorDetails