Cytochrome P450 3A7

Details

Name
Cytochrome P450 3A7
Synonyms
  • 1.14.14.1
  • CYPIIIA7
  • Cytochrome P450-HFLA
Gene Name
CYP3A7
Organism
Human
Amino acid sequence
>lcl|BSEQ0006949|Cytochrome P450 3A7
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETVSGA
Number of residues
503
Molecular Weight
57525.03
Theoretical pI
9.59
GO Classification
Functions
iron ion binding / heme binding / monooxygenase activity / oxygen binding / aromatase activity
Processes
small molecule metabolic process / xenobiotic metabolic process
Components
endoplasmic reticulum membrane
General Function
Oxygen binding
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0019448|Cytochrome P450 3A7 (CYP3A7)
ATGGATCTCATCCCAAACTTGGCCGTGGAAACCTGGCTTCTCCTGGCTGTCAGCCTGATA
CTCCTCTATCTATATGGAACCCGTACACATGGACTTTTTAAGAAGCTTGGAATTCCAGGG
CCCACACCTCTGCCTTTTTTGGGAAATGCTTTGTCCTTCCGTAAGGGCTATTGGACGTTT
GACATGGAATGTTATAAAAAGTATAGAAAAGTCTGGGGTATTTATGACTGTCAACAGCCT
ATGCTGGCTATCACAGATCCCGACATGATCAAAACAGTGCTAGTGAAAGAATGTTATTCT
GTCTTCACAAACCGGAGGCCTTTCGGGCCAGTGGGATTTATGAAAAATGCCATCTCTATA
GCTGAGGATGAAGAATGGAAGAGAATACGATCATTGCTGTCTCCAACATTCACCAGCGGA
AAACTCAAGGAGATGGTCCCTATCATTGCCCAGTATGGAGATGTGTTGGTGAGAAATCTG
AGGCGGGAAGCAGAGACAGGCAAGCCTGTCACCTTGAAACACGTCTTTGGGGCCTACAGC
ATGGATGTGATCACTAGCACATCATTTGGAGTGAGCATCGACTCTCTCAACAATCCACAA
GACCCCTTTGTGGAAAACACCAAGAAGCTTTTAAGATTTAATCCATTAGATCCATTCGTT
CTCTCAATAAAAGTCTTTCCATTCCTTACCCCAATTCTTGAAGCATTAAATATCACTGTG
TTTCCAAGAAAAGTTATAAGTTTTCTAACAAAATCTGTAAAACAGATAAAAGAAGGTCGC
CTCAAAGAGACACAAAAGCACCGAGTGGATTTCCTTCAGCTGATGATTGACTCTCAGAAT
TCAAAAGACTCTGAGACCCACAAAGCTCTGTCTGATCTGGAGCTCATGGCCCAATCAATT
ATCTTTATTTTTGCTGGCTATGAAACCACGAGCAGTGTTCTCTCCTTCATTATATATGAA
CTGGCCACTCACCCTGATGTCCAGCAGAAAGTGCAGAAGGAAATTGATACAGTTTTACCC
AATAAGGCACCACCCACCTATGATACTGTGCTACAGTTGGAGTATCTTGACATGGTGGTG
AATGAAACACTCAGATTATTCCCAGTTGCTATGAGACTTGAGAGGGTCTGCAAAAAAGAT
GTTGAAATCAATGGGATGTTTATTCCCAAAGGGGTGGTGGTGATGATTCCAAGCTATGTT
CTTCATCATGACCCAAAGTACTGGACAGAGCCTGAGAAGTTCCTCCCTGAAAGGTTCAGT
AAAAAGAACAAGGACAACATAGATCCTTACATATACACACCCTTTGGAAGTGGACCCAGA
AACTGCATTGGCATGAGGTTTGCTCTCGTGAACATGAAACTTGCTCTAGTCAGAGTCCTT
CAGAACTTCTCCTTCAAACCTTGTAAAGAAACACAGATCCCCCTGAAATTACGCTTTGGA
GGACTTCTTCTAACAGAAAAACCCATTGTTCTAAAGGCTGAGTCAAGGGATGAGACCTTT
GTAGATATGGAGCCCATTCACATGGACTTTTTAAGAAGCTTGGCATTCCAGGGCCCACAC
CTCTGCTTTTTTTGGGAACTACTTTGTCCTACCATCAGATCCCGCTGA
Chromosome Location
7
Locus
7q21-q22.1
External Identifiers
ResourceLink
UniProtKB IDP24462
UniProtKB Entry NameCP3A7_HUMAN
GenBank Protein ID220149
GenBank Gene IDD00408
HGNC IDHGNC:2640
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01211ClarithromycinapprovedunknownsubstrateDetails
DB00199Erythromycinapproved, investigational, vet_approvednosubstrateinhibitorDetails
DB00976TelithromycinapprovedunknownsubstrateinhibitorDetails
DB00908Quinidineapproved, investigationalunknownsubstrateDetails
DB00404Alprazolamapproved, illicit, investigationalunknownsubstrateDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00683Midazolamapproved, illicitunknownsubstrateinhibitorDetails
DB00897Triazolamapproved, investigationalunknownsubstrateDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB00864Tacrolimusapproved, investigationalunknownsubstrateDetails
DB00224IndinavirapprovedunknownsubstrateinhibitorDetails
DB00220NelfinavirapprovedunknownsubstrateinhibitorDetails
DB01232Saquinavirapproved, investigationalunknownsubstrateinhibitorDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00637Astemizoleapproved, withdrawnunknownsubstrateDetails
DB01114ChlorphenamineapprovedunknownsubstrateDetails
DB00342Terfenadineapproved, withdrawnunknownsubstrateDetails
DB00381AmlodipineapprovedunknownsubstrateDetails
DB00343Diltiazemapproved, investigationalunknownsubstrateinhibitorDetails
DB01023Felodipineapproved, investigationalunknownsubstrateDetails
DB00528Lercanidipineapproved, investigationalunknownsubstrateDetails
DB01115NifedipineapprovedunknownsubstrateDetails
DB00401NisoldipineapprovedunknownsubstrateDetails
DB01054Nitrendipineapproved, investigationalunknownsubstrateDetails
DB00661VerapamilapprovedunknownsubstrateinhibitorDetails
DB01076AtorvastatinapprovedunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateDetails
DB00227Lovastatinapproved, investigationalunknownsubstrateDetails
DB00641SimvastatinapprovedunknownsubstrateDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateDetails
DB00741Hydrocortisoneapproved, vet_approvedunknownsubstrateDetails
DB00396Progesteroneapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB00802Alfentanilapproved, illicitunknownsubstrateDetails
DB00673Aprepitantapproved, investigationalunknownsubstrateinhibitorDetails
DB01238Aripiprazoleapproved, investigationalunknownsubstrateDetails
DB00490Buspironeapproved, investigationalunknownsubstrateDetails
DB00201CaffeineapprovedunknownsubstrateDetails
DB01166Cilostazolapproved, investigationalunknownsubstrateDetails
DB00907Cocaineapproved, illicitunknownsubstrateDetails
DB00318Codeineapproved, illicitunknownsubstrateDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB00514DextromethorphanapprovedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00700EplerenoneapprovedunknownsubstrateDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB01216FinasterideapprovedunknownsubstrateDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00502HaloperidolapprovedunknownsubstrateDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB01227Levomethadyl acetateapproved, investigationalunknownsubstrateDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB00731Nateglinideapproved, investigationalunknownsubstrateDetails
DB00904OndansetronapprovedunknownsubstrateDetails
DB01100PimozideapprovedunknownsubstrateDetails
DB00571Propranololapproved, investigationalunknownsubstrateDetails
DB01224QuetiapineapprovedunknownsubstrateDetails
DB00468QuinineapprovedunknownsubstrateDetails
DB00734Risperidoneapproved, investigationalunknownsubstrateDetails
DB00938SalmeterolapprovedunknownsubstrateDetails
DB00203Sildenafilapproved, investigationalunknownsubstrateDetails
DB00877Sirolimusapproved, investigationalunknownsubstrateDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateDetails
DB01268Sunitinibapproved, investigationalunknownsubstrateDetails
DB00675TamoxifenapprovedunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateDetails
DB06287TemsirolimusapprovedunknownsubstrateDetails
DB00656Trazodoneapproved, investigationalunknownsubstrateDetails
DB00541Vincristineapproved, investigationalunknownsubstrateDetails
DB00962Zaleplonapproved, illicit, investigationalunknownsubstrateDetails
DB00246ZiprasidoneapprovedunknownsubstrateDetails
DB00425ZolpidemapprovedunknownsubstrateDetails
DB01167Itraconazoleapproved, investigationalunknowninhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB00196Fluconazoleapproved, investigationalunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB01118Amiodaroneapproved, investigationalunknowninhibitorDetails
DB00446Chloramphenicolapproved, vet_approvedunknowninhibitorDetails
DB00537Ciprofloxacinapproved, investigationalunknowninhibitorDetails
DB00705DelavirdineapprovedunknowninhibitorDetails
DB00176Fluvoxamineapproved, investigationalunknowninhibitorDetails
DB06730Gestodeneapproved, investigationalunknowninhibitorDetails
DB01388Mibefradilinvestigational, withdrawnunknowninhibitorDetails
DB00834Mifepristoneapproved, investigationalunknowninhibitorDetails
DB01059NorfloxacinapprovedunknowninhibitorDetails
DB06731SeproxetineinvestigationalunknowninhibitorDetails
DB00582Voriconazoleapproved, investigationalunknowninhibitorDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninducerDetails
DB00458ImipramineapprovedunknownsubstrateDetails
DB00717NorethisteroneapprovedunknownsubstrateDetails
DB00780PhenelzineapprovedunknowninhibitorDetails
DB00252Phenytoinapproved, vet_approvedunknowninducerDetails
DB01058Praziquantelapproved, investigational, vet_approvedunknownsubstrateDetails
DB01045RifampicinapprovedunknowninducerDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninhibitorDetails
DB00588Fluticasone propionateapprovedunknownsubstrateDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB04946IloperidoneapprovedunknownsubstrateDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownsubstrateinhibitorDetails
DB05804Prasterone sulfateinvestigationalunknownsubstrateDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB09102Daclatasvirapproved, investigationalunknownsubstrateDetails
DB09054IdelalisibapprovednosubstrateinhibitorDetails
DB09065CobicistatapprovedyessubstrateinhibitorDetails
DB06412Oxymetholoneapproved, illicitnoinhibitorDetails
DB00503Ritonavirapproved, investigationalnosubstrateinhibitorinducerDetails
DB06595Midostaurinapproved, investigationalunknowninducerDetails
DB11574ElbasvirapprovedunknownsubstrateinhibitorDetails
DB12483Copanlisibapproved, investigationalnosubstrateDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownsubstrateDetails
DB14011Nabiximolsapproved, investigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB00625Efavirenzapproved, investigationalunknowninducerDetails
DB13179TroleandomycinapprovedunknowninhibitorDetails
DB14185Aripiprazole lauroxilapproved, investigationalunknownsubstrateDetails
DB12070Letermovirapproved, investigationalnoinhibitorDetails
DB14538Hydrocortisone aceponateexperimental, vet_approvedunknownsubstrateDetails
DB14539Hydrocortisone acetateapproved, vet_approvedunknownsubstrateDetails
DB14540Hydrocortisone butyrateapproved, vet_approvedunknownsubstrateDetails
DB14541Hydrocortisone cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB14542Hydrocortisone phosphateapproved, vet_approvedunknownsubstrateDetails
DB14543Hydrocortisone probutateapproved, vet_approvedunknownsubstrateDetails
DB14544Hydrocortisone valerateapproved, vet_approvedunknownsubstrateDetails
DB14545Hydrocortisone succinateapprovednosubstrateDetails
DB08930DolutegravirapprovedunknownsubstrateDetails
DB06595Midostaurinapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB13174RheinexperimentalunknowninhibitorDetails
DB11994Diacereinapproved, investigationalunknowninhibitorDetails
DB11605MyrrhapprovedunknowninducerDetails
DB11691Naldemedineapproved, investigationalnosubstrateDetails
DB13878Pibrentasvirapproved, investigationalunknowninhibitorDetails
DB13879Glecaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateDetails
DB09568Omega-3-carboxylic acidsapproved, investigationalnosubstrateDetails
DB01601LopinavirapprovednoinhibitorDetails
DB01149Nefazodoneapproved, withdrawnnoinhibitorDetails
DB11431Moxidectinapproved, investigational, vet_approvednosubstrateDetails
DB13141Ambroxol acefyllinateexperimental, investigationalnosubstrateDetails
DB11792MirodenafilinvestigationalunknownsubstrateDetails
DB11979Elagolixapproved, investigationalyessubstrateDetails
DB08865CrizotinibapprovedunknowninhibitorDetails
DB11703Acalabrutinibapproved, investigationalunknownsubstrateDetails
DB12267Brigatinibapproved, investigationalunknowninducerDetails
DB12307ForetinibinvestigationalunknownsubstrateDetails
DB00400Griseofulvinapproved, investigational, vet_approvedunknowninhibitorDetails
DB09205Moxisylyteapproved, investigationalnosubstrateDetails