Cytochrome P450 2B6

Details

Name
Cytochrome P450 2B6
Synonyms
  • 1,4-cineole 2-exo-monooxygenase
  • 1.14.13.-
  • CYPIIB6
  • Cytochrome P450 IIB1
Gene Name
CYP2B6
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006839|Cytochrome P450 2B6
MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNR
WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIIC
SIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFS
DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKI
PPTYQIRFLPR
Number of residues
491
Molecular Weight
56277.81
Theoretical pI
8.44
GO Classification
Functions
arachidonic acid epoxygenase activity / heme binding / iron ion binding / monooxygenase activity / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / oxygen binding / steroid hydroxylase activity
Processes
cellular ketone metabolic process / drug metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / oxidation-reduction process / small molecule metabolic process / steroid metabolic process / xenobiotic metabolic process
Components
cytoplasm / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Steroid hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,4-cineole 2-exo-monooxygenase.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0019435|Cytochrome P450 2B6 (CYP2B6)
ATGGAACTCAGCGTCCTCCTCTTCCTTGCACTCCTCACAGGACTCTTGCTACTCCTGGTT
CAGCGCCACCCTAACACCCATGACCGCCTCCCACCAGGGCCCCGCCCTCTGCCCCTTTTG
GGAAACCTTCTGCAGATGGATAGAAGAGGCCTACTCAAATCCTTTCTGAGGTTCCGAGAG
AAATATGGGGACGTCTTCACGGTACACCTGGGACCGAGGCCCGTGGTCATGCTGTGTGGA
GTAGAGGCCATACGGGAGGCCCTTGTGGACAAGGCTGAGGCCTTCTCTGGCCGGGGAAAA
ATCGCCATGGTCGACCCATTCTTCCGGGGATATGGTGTGATCTTTGCCAATGGAAACCGC
TGGAAGGTGCTTCGGCGATTCTCTGTGACCACTATGAGGGACTTCGGGATGGGAAAGCGG
AGTGTGGAGGAGCGGATTCAGGAGGAGGCTCAGTGTCTGATAGAGGAGCTTCGGAAATCC
AAGGGGGCCCTCATGGACCCCACCTTCCTCTTCCAGTCCATTACCGCCAACATCATCTGC
TCCATCGTCTTTGGAAAACGATTCCACTACCAAGATCAAGAGTTCCTGAAGATGCTGAAC
TTGTTCTACCAGACTTTTTCACTCATCAGCTCTGTATTCGGCCAGCTGTTTGAGCTCTTC
TCTGGCTTCTTGAAATACTTTCCTGGGGCACACAGGCAAGTTTACAAAAACCTGCAGGAA
ATCAATGCTTACATTGGCCACAGTGTGGAGAAGCACCGTGAAACCCTGGACCCCAGCGCC
CCCAAGGACCTCATCGACACCTACCTGCTCCACATGGAAAAAGAGAAATCCAACGCACAC
AGTGAATTCAGCCACCAGAACCTCAACCTCAACACGCTCTCGCTCTTCTTTGCTGGCACT
GAGACCACCAGCACCACTCTCCGCTACGGCTTCCTGCTCATGCTCAAATACCCTCATGTT
GCAGAGAGAGTCTACAGGGAGATTGAACAGGTGATTGGCCCACATCGCCCTCCAGAGCTT
CATGACCGAGCCAAAATGCCATACACAGAGGCAGTCATCTATGAGATTCAGAGATTTTCC
GACCTTCTCCCCATGGGTGTGCCCCACATTGTCACCCAACACACCAGCTTCCGAGGGTAC
ATCATCCCCAAGGACACAGAAGTATTTCTCATCCTGAGCACTGCTCTCCATGACCCACAC
TACTTTGAAAAACCAGACGCCTTCAATCCTGACCACTTTCTGGATGCCAATGGGGCACTG
AAAAAGACTGAAGCTTTTATCCCCTTCTCCTTAGGGAAGCGGATTTGTCTTGGTGAAGGC
ATCGCCCGTGCGGAATTGTTCCTCTTCTTCACCACCATCCTCCAGAACTTCTCCATGGCC
AGCCCCGTGGCCCCAGAAGACATCGATCTGACACCCCAGGAGTGTGGTGTGGGCAAAATA
CCCCCAACATACCAGATCCGCTTCCTGCCCCGCTGA
Chromosome Location
19
Locus
19q13.2
External Identifiers
ResourceLink
UniProtKB IDP20813
UniProtKB Entry NameCP2B6_HUMAN
GenBank Protein ID181296
GenBank Gene IDM29874
HGNC IDHGNC:2615
General References
  1. Yamano S, Nhamburo PT, Aoyama T, Meyer UA, Inaba T, Kalow W, Gelboin HV, McBride OW, Gonzalez FJ: cDNA cloning and sequence and cDNA-directed expression of human P450 IIB1: identification of a normal and two variant cDNAs derived from the CYP2B locus on chromosome 19 and differential expression of the IIB mRNAs in human liver. Biochemistry. 1989 Sep 5;28(18):7340-8. [PubMed:2573390]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  4. Miles JS, McLaren AW, Wolf CR: Alternative splicing in the human cytochrome P450IIB6 gene generates a high level of aberrant messages. Nucleic Acids Res. 1989 Oct 25;17(20):8241-55. [PubMed:2813061]
  5. Thum T, Borlak J: Gene expression in distinct regions of the heart. Lancet. 2000 Mar 18;355(9208):979-83. [PubMed:10768437]
  6. Miyazawa M, Shindo M, Shimada T: Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes. Xenobiotica. 2001 Oct;31(10):713-23. [PubMed:11695850]
  7. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  8. Gay SC, Shah MB, Talakad JC, Maekawa K, Roberts AG, Wilderman PR, Sun L, Yang JY, Huelga SC, Hong WX, Zhang Q, Stout CD, Halpert JR: Crystal structure of a cytochrome P450 2B6 genetic variant in complex with the inhibitor 4-(4-chlorophenyl)imidazole at 2.0-A resolution. Mol Pharmacol. 2010 Apr;77(4):529-38. doi: 10.1124/mol.109.062570. Epub 2010 Jan 8. [PubMed:20061448]
  9. Shah MB, Pascual J, Zhang Q, Stout CD, Halpert JR: Structures of cytochrome P450 2B6 bound to 4-benzylpyridine and 4-(4-nitrobenzyl)pyridine: insight into inhibitor binding and rearrangement of active site side chains. Mol Pharmacol. 2011 Dec;80(6):1047-55. doi: 10.1124/mol.111.074427. Epub 2011 Aug 29. [PubMed:21875942]
  10. Shah MB, Wilderman PR, Pascual J, Zhang Q, Stout CD, Halpert JR: Conformational adaptation of human cytochrome P450 2B6 and rabbit cytochrome P450 2B4 revealed upon binding multiple amlodipine molecules. Biochemistry. 2012 Sep 18;51(37):7225-38. doi: 10.1021/bi300894z. Epub 2012 Sep 4. [PubMed:22909231]
  11. Haas DW, Ribaudo HJ, Kim RB, Tierney C, Wilkinson GR, Gulick RM, Clifford DB, Hulgan T, Marzolini C, Acosta EP: Pharmacogenetics of efavirenz and central nervous system side effects: an Adult AIDS Clinical Trials Group study. AIDS. 2004 Dec 3;18(18):2391-400. [PubMed:15622315]
  12. Carr DF, la Porte CJ, Pirmohamed M, Owen A, Cortes CP: Haplotype structure of CYP2B6 and association with plasma efavirenz concentrations in a Chilean HIV cohort. J Antimicrob Chemother. 2010 Sep;65(9):1889-93. doi: 10.1093/jac/dkq260. Epub 2010 Jul 17. [PubMed:20639527]
  13. Elens L, Vandercam B, Yombi JC, Lison D, Wallemacq P, Haufroid V: Influence of host genetic factors on efavirenz plasma and intracellular pharmacokinetics in HIV-1-infected patients. Pharmacogenomics. 2010 Sep;11(9):1223-34. doi: 10.2217/pgs.10.94. [PubMed:20860463]
  14. Ariyoshi N, Miyazaki M, Toide K, Sawamura Yi, Kamataki T: A single nucleotide polymorphism of CYP2b6 found in Japanese enhances catalytic activity by autoactivation. Biochem Biophys Res Commun. 2001 Mar;281(5):1256-60. [PubMed:11243870]
  15. Lang T, Klein K, Fischer J, Nussler AK, Neuhaus P, Hofmann U, Eichelbaum M, Schwab M, Zanger UM: Extensive genetic polymorphism in the human CYP2B6 gene with impact on expression and function in human liver. Pharmacogenetics. 2001 Jul;11(5):399-415. [PubMed:11470993]
  16. Jinno H, Tanaka-Kagawa T, Ohno A, Makino Y, Matsushima E, Hanioka N, Ando M: Functional characterization of cytochrome P450 2B6 allelic variants. Drug Metab Dispos. 2003 Apr;31(4):398-403. [PubMed:12642465]
  17. Saito S, Iida A, Sekine A, Kawauchi S, Higuchi S, Ogawa C, Nakamura Y: Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population. J Hum Genet. 2003;48(5):249-70. Epub 2003 Apr 29. [PubMed:12721789]
  18. Lamba V, Lamba J, Yasuda K, Strom S, Davila J, Hancock ML, Fackenthal JD, Rogan PK, Ring B, Wrighton SA, Schuetz EG: Hepatic CYP2B6 expression: gender and ethnic differences and relationship to CYP2B6 genotype and CAR (constitutive androstane receptor) expression. J Pharmacol Exp Ther. 2003 Dec;307(3):906-22. Epub 2003 Oct 9. [PubMed:14551287]
  19. Lang T, Klein K, Richter T, Zibat A, Kerb R, Eichelbaum M, Schwab M, Zanger UM: Multiple novel nonsynonymous CYP2B6 gene polymorphisms in Caucasians: demonstration of phenotypic null alleles. J Pharmacol Exp Ther. 2004 Oct;311(1):34-43. Epub 2004 Jun 9. [PubMed:15190123]
  20. Solus JF, Arietta BJ, Harris JR, Sexton DP, Steward JQ, McMunn C, Ihrie P, Mehall JM, Edwards TL, Dawson EP: Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population. Pharmacogenomics. 2004 Oct;5(7):895-931. [PubMed:15469410]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB029744-(4-Chlorophenyl)ImidazoleexperimentalunknownDetails
DB04664Cyclohexyl-pentyl-maltosideexperimentalunknownDetails
DB04794Bifonazoleapproved, investigationalunknownDetails
DB00333Methadoneapproved, illicitunknownsubstrateDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateinducerDetails
DB00532Mephenytoinapproved, investigational, withdrawnunknownsubstrateDetails
DB00625Efavirenzapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB01104SertralineapprovedunknownsubstrateinhibitorDetails
DB01156BupropionapprovedunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateDetails
DB00184NicotineapprovedunknownsubstrateDetails
DB00208TiclopidineapprovedunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00238NevirapineapprovedunknownsubstrateinducerDetails
DB00252Phenytoinapproved, vet_approvedunknowninducerDetails
DB00454MeperidineapprovedunknownsubstrateDetails
DB00503Ritonavirapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00564Carbamazepineapproved, investigationalunknowninducerDetails
DB00758ClopidogrelapprovedunknownsubstrateinhibitorDetails
DB00818Propofolapproved, investigational, vet_approvedunknownsubstrateDetails
DB00849MethylphenobarbitalapprovedunknownsubstrateDetails
DB01037Selegilineapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB01043Memantineapproved, investigationalunknowninhibitorDetails
DB01173OrphenadrineapprovedunknowninhibitorDetails
DB00381AmlodipineapprovedunknownsubstrateinhibitorDetails
DB00675TamoxifenapprovedunknownsubstrateinhibitorDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateDetails
DB00568Cinnarizineapproved, investigationalunknownsubstrateDetails
DB00398Sorafenibapproved, investigationalunknowninhibitorDetails
DB04572Thiotepaapproved, investigationalunknowninhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB01045RifampicinapprovedunknowninducerDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB01069Promethazineapproved, investigationalunknownsubstrateDetails
DB01221Ketamineapproved, vet_approvedunknownsubstrateDetails
DB01320Fosphenytoinapproved, investigationalunknowninducerDetails
DB00794Primidoneapproved, vet_approvedunknowninducerDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB00997Doxorubicinapproved, investigationalunknowninhibitorDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorinducerDetails
DB01167Itraconazoleapproved, investigationalunknowninhibitorDetails
DB00481Raloxifeneapproved, investigationalunknowninhibitorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00641SimvastatinapprovedunknowninhibitorinducerDetails
DB00439Cerivastatinapproved, withdrawnunknowninducerDetails
DB01076AtorvastatinapprovednoinducerDetails
DB06739SeratrodastexperimentalunknownsubstrateDetails
DB00514DextromethorphanapprovedunknownsubstrateDetails
DB03575PhencyclidineillicitunknowninhibitorDetails
DB00865Benzphetamineapproved, illicitunknownsubstrateDetails
DB083691-(biphenyl-4-ylmethyl)-1H-imidazoleexperimentalunknownDetails
DB06697ArtemetherapprovedunknownsubstrateinducerDetails
DB00321AmitriptylineapprovedunknownsubstrateDetails
DB00701Amprenavirapproved, investigationalunknowninhibitorDetails
DB00972AzelastineapprovedunknowninhibitorDetails
DB00835BrompheniramineapprovedunknownsubstrateDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00349Clobazamapproved, illicitunknownsubstrateDetails
DB00636Clofibrateapproved, investigationalunknowninducerDetails
DB06470ClomethiazoleinvestigationalunknownsubstrateDetails
DB01559Clotiazepamapproved, illicitunknownsubstrateDetails
DB01394ColchicineapprovedunknowninhibitorDetails
DB00169Cholecalciferolapproved, nutraceuticalunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00751Epinastineapproved, investigationalunknownsubstrateDetails
DB00655EstroneapprovedunknownsubstrateDetails
DB00898EthanolapprovedunknowninhibitorDetails
DB01466Ethylmorphineexperimental, illicitunknownsubstrateDetails
DB01544Flunitrazepamapproved, illicitunknownsubstrateDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateDetails
DB00176Fluvoxamineapproved, investigationalunknowninhibitorDetails
DB01159Halothaneapproved, vet_approvedunknownsubstrateDetails
DB00458ImipramineapprovedunknownsubstrateDetails
DB00753Isofluraneapproved, vet_approvedunknownsubstrateinhibitorinducerDetails
DB06738KetobemidoneinvestigationalunknownsubstrateDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB01601LopinavirapprovedunknowninhibitorDetails
DB00772Malathionapproved, investigationalunknownsubstrateDetails
DB04817Metamizoleapproved, investigational, withdrawnunknowninducerDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedunknownsubstrateDetails
DB06710MethyltestosteroneapprovedunknownsubstrateDetails
DB00379Mexiletineapproved, investigationalunknownsubstrateDetails
DB06148Mianserinapproved, investigationalunknownsubstrateDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00745Modafinilapproved, investigationalunknowninhibitorinducerDetails
DB00622Nicardipineapproved, investigationalunknowninducerDetails
DB01115NifedipineapprovedunknowninducerDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails
DB01074Perhexilineapproved, investigationalunknownsubstrateDetails
DB04930Permethrinapproved, investigationalunknownsubstrateinducerDetails
DB00850PerphenazineapprovedunknownsubstrateDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB00296RopivacaineapprovedunknownsubstrateDetails
DB00778Roxithromycinapproved, investigational, withdrawnunknowninhibitorDetails
DB01236Sevofluraneapproved, vet_approvedunknownsubstrateDetails
DB06729SulfaphenazoleapprovedunknowninhibitorDetails
DB01138SulfinpyrazoneapprovedunknowninducerDetails
DB00231Temazepamapproved, investigationalunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateinducerDetails
DB00763MethimazoleapprovedunknowninhibitorDetails
DB00193Tramadolapproved, investigationalunknownsubstrateDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninducerDetails
DB00661VerapamilapprovedunknownsubstrateinducerDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB04868Nilotinibapproved, investigationalunknowninducerDetails
DB06413Armodafinilapproved, investigationalunknowninducerDetails
DB00836LoperamideapprovedunknownsubstrateDetails
DB04975BanoxantroneinvestigationalunknownsubstrateDetails
DB00435Nitric OxideapprovedunknowninhibitorDetails
DB00515CisplatinapprovedunknowninhibitorDetails
DB06209PrasugrelapprovedyessubstrateDetails
DB04871LorcaserinapprovednosubstrateDetails
DB08864RilpivirineapprovedunknowninhibitorDetails
DB08896RegorafenibapprovedunknowninhibitorDetails
DB08899EnzalutamideapprovedunknowninhibitorDetails
DB04938Ospemifeneapproved, investigationalunknownsubstrateDetails
DB09074OlaparibapprovedunknowninducerDetails
DB09054IdelalisibapprovednoinducerDetails
DB09068Vortioxetineapproved, investigationalnosubstrateDetails
DB09280LumacaftorapprovednoinducerDetails
DB09570Ixazomibapproved, investigationalunknownsubstrateDetails
DB06176Romidepsinapproved, investigationalunknownsubstrateDetails
DB01589Quazepamapproved, illicitunknowninhibitorDetails
DB08865CrizotinibapprovedunknowninhibitorDetails
DB05219Crisaboroleapproved, investigationalnoinhibitorDetails
DB06595Midostaurinapproved, investigationalunknowninducerDetails
DB11613Velpatasvirapproved, investigationalnosubstrateDetails
DB05541Brivaracetamapproved, investigationalnosubstrateDetails
DB09238Manidipineapproved, investigationalunknowninhibitorDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB12070Letermovirapproved, investigationalnoinducerDetails
DB13943Testosterone cypionateapprovedunknownsubstrateinducerDetails
DB13944Testosterone enanthateapprovedunknownsubstrateinducerDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateinducerDetails
DB13941Piperaquineexperimental, investigationalunknowninhibitorDetails
DB11642Pitolisantapproved, investigationalunknowninducerDetails
DB11633Isavuconazoleapproved, investigationalunknowninducerDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateDetails
DB11672Curcuminapproved, experimental, investigationalunknowninhibitorDetails
DB13132ArtemisinininvestigationalnosubstrateDetails
DB00582Voriconazoleapproved, investigationalunknowninhibitorDetails
DB14568Ivosidenibapproved, investigationalunknowninducerDetails
DB00615Rifabutinapproved, investigationalnoinducerDetails
DB11753Rifamycinapproved, investigationalnoinhibitorinducerDetails
DB01201Rifapentineapproved, investigationalnoinducerDetails
DB06654Safinamideapproved, investigationalunknowninhibitorDetails
DB08883PerampanelapprovedunknownDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB14635Curcumin sulfateexperimentalunknownDetails
DB01095FluvastatinapprovedunknowninducerDetails
DB08912Dabrafenibapproved, investigationalunknowninducerDetails
DB08881VemurafenibapprovedunknowninducerDetails
DB12130Lorlatinibapproved, investigationalunknowninducerDetails
DB12245Triclabendazoleapproved, investigationalunknowninhibitorDetails
DB11823Esketamineapproved, investigationalunknownsubstrateinducerDetails
DB00455Loratadineapproved, investigationalunknownDetails