Cytochrome P450 3A5

Details

Name
Cytochrome P450 3A5
Synonyms
  • 1.14.14.1
  • CYPIIIA5
  • Cytochrome P450 HLp2
  • Cytochrome P450-PCN3
Gene Name
CYP3A5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004639|Cytochrome P450 3A5
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE
Number of residues
502
Molecular Weight
57108.065
Theoretical pI
9.09
GO Classification
Functions
aromatase activity / heme binding / iron ion binding / monooxygenase activity / oxidoreductase activity / oxygen binding
Processes
alkaloid catabolic process / drug catabolic process / oxidative demethylation / small molecule metabolic process / steroid metabolic process / xenobiotic metabolic process
Components
endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Oxygen binding
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0016766|Cytochrome P450 3A5 (CYP3A5)
ATGGACCTCATCCCAAATTTGGCGGTGGAAACCTGGCTTCTCCTGGCTGTCAGCCTGGTG
CTCCTCTATCTATATGGGACCCGTACACATGGACTTTTTAAGAGACTGGGAATTCCAGGG
CCCACACCTCTGCCTTTGTTGGGAAATGTTTTGTCCTATCGTCAGGGTCTCTGGAAATTT
GACACAGAGTGCTATAAAAAGTATGGAAAAATGTGGGGAACGTATGAAGGTCAACTCCCT
GTGCTGGCCATCACAGATCCCGACGTGATCAGAACAGTGCTAGTGAAAGAATGTTATTCT
GTCTTCACAAATCGAAGGTCTTTAGGCCCAGTGGGATTTATGAAAAGTGCCATCTCTTTA
GCTGAGGATGAAGAATGGAAGAGAATACGGTCATTGCTGTCTCCAACCTTCACCAGCGGA
AAACTCAAGGAGATGTTCCCCATCATTGCCCAGTATGGAGATGTATTGGTGAGAAACTTG
AGGCGGGAAGCAGAGAAAGGCAAGCCTGTCACCTTGAAAGACATCTTTGGGGCCTACAGC
ATGGATGTGATTACTGGCACATCATTTGGAGTGAACATCGACTCTCTCAACAATCCACAA
GACCCCTTTGTGGAGAGCACTAAGAAGTTCCTAAAATTTGGTTTCTTAGATCCATTATTT
CTCTCAATAATACTCTTTCCATTCCTTACCCCAGTTTTTGAAGCATTAAATGTCTCTCTG
TTTCCAAAAGATACCATAAATTTTTTAAGTAAATCTGTAAACAGAATGAAGAAAAGTCGC
CTCAACGACAAACAAAAGCACCGACTAGATTTCCTTCAGCTGATGATTGACTCCCAGAAT
TCGAAAGAAACTGAGTCCCACAAAGCTCTGTCTGATCTGGAGCTCGCAGCCCAGTCAATA
ATCTTCATTTTTGCTGGCTATGAAACCACCAGCAGTGTTCTTTCCTTCACTTTATATGAA
CTGGCCACTCACCCTGATGTCCAGCAGAAACTGCAAAAGGAGATTGATGCAGTTTTGCCC
AATAAGGCACCACCTACCTATGATGCCGTGGTACAGATGGAGTACCTTGACATGGTGGTG
AATGAAACACTCAGATTATTCCCAGTTGCTATTAGACTTGAGAGGACTTGCAAGAAAGAT
GTTGAAATCAATGGGGTATTCATTCCCAAAGGGTCAATGGTGGTGATTCCAACTTATGCT
CTTCACCATGACCCAAAGTACTGGACAGAGCCTGAGGAGTTCCGCCCTGAAAGGTTCAGT
AAGAAGAAGGACAGCATAGATCCTTACATATACACACCCTTTGGAACTGGACCCAGAAAC
TGCATTGGCATGAGGTTTGCTCTCATGAACATGAAACTTGCTCTAATCAGAGTCCTTCAG
AACTTCTCCTTCAAACCTTGTAAAGAAACACAGATCCCCTTGAAATTAGACACGCAAGGA
CTTCTTCAACCAGAAAAACCCATTGTTCTAAAGGTGGATTCAAGAGATGGAACCCTAAGT
GGAGAATGA
Chromosome Location
7
Locus
7q21.1
External Identifiers
ResourceLink
UniProtKB IDP20815
UniProtKB Entry NameCP3A5_HUMAN
GenBank Protein ID181346
GenBank Gene IDJ04813
GenAtlas IDCYP3A5
HGNC IDHGNC:2638
General References
  1. Aoyama T, Yamano S, Waxman DJ, Lapenson DP, Meyer UA, Fischer V, Tyndale R, Inaba T, Kalow W, Gelboin HV, et al.: Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine. J Biol Chem. 1989 Jun 25;264(18):10388-95. [PubMed:2732228]
  2. Schuetz JD, Molowa DT, Guzelian PS: Characterization of a cDNA encoding a new member of the glucocorticoid-responsive cytochromes P450 in human liver. Arch Biochem Biophys. 1989 Nov 1;274(2):355-65. [PubMed:2802615]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205]
  5. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Gellner K, Eiselt R, Hustert E, Arnold H, Koch I, Haberl M, Deglmann CJ, Burk O, Buntefuss D, Escher S, Bishop C, Koebe HG, Brinkmann U, Klenk HP, Kleine K, Meyer UA, Wojnowski L: Genomic organization of the human CYP3A locus: identification of a new, inducible CYP3A gene. Pharmacogenetics. 2001 Mar;11(2):111-21. [PubMed:11266076]
  8. Schuetz JD, Schuetz EG, Thottassery JV, Guzelian PS, Strom S, Sun D: Identification of a novel dexamethasone responsive enhancer in the human CYP3A5 gene and its activation in human and rat liver cells. Mol Pharmacol. 1996 Jan;49(1):63-72. [PubMed:8569713]
  9. Jounaidi Y, Guzelian PS, Maurel P, Vilarem MJ: Sequence of the 5'-flanking region of CYP3A5: comparative analysis with CYP3A4 and CYP3A7. Biochem Biophys Res Commun. 1994 Dec 30;205(3):1741-7. [PubMed:7811260]
  10. Finta C, Zaphiropoulos PG: Intergenic mRNA molecules resulting from trans-splicing. J Biol Chem. 2002 Feb 22;277(8):5882-90. Epub 2001 Nov 28. [PubMed:11726664]
  11. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  12. Jounaidi Y, Hyrailles V, Gervot L, Maurel P: Detection of CYP3A5 allelic variant: a candidate for the polymorphic expression of the protein? Biochem Biophys Res Commun. 1996 Apr 16;221(2):466-70. [PubMed:8619878]
  13. Chou FC, Tzeng SJ, Huang JD: Genetic polymorphism of cytochrome P450 3A5 in Chinese. Drug Metab Dispos. 2001 Sep;29(9):1205-9. [PubMed:11502729]
  14. Lee SJ, Usmani KA, Chanas B, Ghanayem B, Xi T, Hodgson E, Mohrenweiser HW, Goldstein JA: Genetic findings and functional studies of human CYP3A5 single nucleotide polymorphisms in different ethnic groups. Pharmacogenetics. 2003 Aug;13(8):461-72. [PubMed:12893984]
  15. Solus JF, Arietta BJ, Harris JR, Sexton DP, Steward JQ, McMunn C, Ihrie P, Mehall JM, Edwards TL, Dawson EP: Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population. Pharmacogenomics. 2004 Oct;5(7):895-931. [PubMed:15469410]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00091Ciclosporinapproved, investigational, vet_approvedunknownsubstrateinhibitorinducerDetails
DB00224IndinavirapprovedunknownsubstrateinhibitorDetails
DB00252Phenytoinapproved, vet_approvednoinducerDetails
DB00468QuinineapprovedunknownsubstrateDetails
DB00541Vincristineapproved, investigationalunknownsubstrateDetails
DB00661VerapamilapprovedunknownsubstrateinhibitorDetails
DB00683Midazolamapproved, illicitunknownsubstrateDetails
DB00694DaunorubicinapprovedunknowninducerDetails
DB00758ClopidogrelapprovedunknownsubstrateDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB00834Mifepristoneapproved, investigationalunknownsubstrateDetails
DB00864Tacrolimusapproved, investigationalunknownsubstrateDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknownsubstrateinhibitorDetails
DB13179TroleandomycinapprovedunknowninhibitorDetails
DB04856DexloxiglumideinvestigationalunknownDetails
DB04957AzimilideinvestigationalunknownDetails
DB06267UdenafilinvestigationalunknownsubstrateDetails
DB06287TemsirolimusapprovedunknownsubstrateinhibitorDetails
DB00802Alfentanilapproved, illicitunknownsubstrateDetails
DB00203Sildenafilapproved, investigationalunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateDetails
DB00321AmitriptylineapprovedunknownsubstrateDetails
DB00540NortriptylineapprovedunknownsubstrateDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00675TamoxifenapprovedunknownsubstrateDetails
DB01041Thalidomideapproved, investigational, withdrawnnoinducerDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00238NevirapineapprovedunknownsubstrateDetails
DB06652VicrivirocinvestigationalunknownsubstrateDetails
DB00972AzelastineapprovedunknownsubstrateDetails
DB01211ClarithromycinapprovedunknownsubstrateinhibitorDetails
DB00976TelithromycinapprovedunknownsubstrateinhibitorDetails
DB00404Alprazolamapproved, illicit, investigationalunknownsubstrateDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00897Triazolamapproved, investigationalunknownsubstrateDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00637Astemizoleapproved, withdrawnunknownsubstrateDetails
DB01114ChlorphenamineapprovedunknownsubstrateDetails
DB00342Terfenadineapproved, withdrawnunknownsubstrateDetails
DB00381AmlodipineapprovedunknownsubstrateDetails
DB00343Diltiazemapproved, investigationalunknownsubstrateinhibitorDetails
DB01023Felodipineapproved, investigationalunknownsubstrateDetails
DB00528Lercanidipineapproved, investigationalunknownsubstrateDetails
DB01115NifedipineapprovedunknownsubstrateDetails
DB00401NisoldipineapprovedunknownsubstrateDetails
DB01054Nitrendipineapproved, investigationalunknownsubstrateDetails
DB01076AtorvastatinapprovedunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateDetails
DB00227Lovastatinapproved, investigationalunknownsubstrateDetails
DB00641SimvastatinapprovedunknownsubstrateDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateDetails
DB00741Hydrocortisoneapproved, vet_approvedunknownsubstrateDetails
DB00396Progesteroneapproved, vet_approvedunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB00673Aprepitantapproved, investigationalunknownsubstrateinhibitorDetails
DB01238Aripiprazoleapproved, investigationalunknownsubstrateDetails
DB00490Buspironeapproved, investigationalunknownsubstrateDetails
DB00201CaffeineapprovedunknownsubstrateDetails
DB01166Cilostazolapproved, investigationalunknownsubstrateDetails
DB00907Cocaineapproved, illicitunknownsubstrateDetails
DB00318Codeineapproved, illicitunknownsubstrateDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB00514DextromethorphanapprovedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00700EplerenoneapprovedunknownsubstrateDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB01216FinasterideapprovedunknownsubstrateDetails
DB00502HaloperidolapprovedunknownsubstrateDetails
DB01227Levacetylmethadolapproved, investigationalunknownsubstrateDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB00731Nateglinideapproved, investigationalunknownsubstrateDetails
DB00904OndansetronapprovedunknownsubstrateDetails
DB01100PimozideapprovedunknownsubstrateDetails
DB00571Propranololapproved, investigationalunknownsubstrateDetails
DB01224QuetiapineapprovedunknownsubstrateDetails
DB00734Risperidoneapproved, investigationalunknownsubstrateDetails
DB00938SalmeterolapprovedunknownsubstrateDetails
DB00877Sirolimusapproved, investigationalunknownsubstrateDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateDetails
DB01268Sunitinibapproved, investigationalunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateDetails
DB00656Trazodoneapproved, investigationalunknownsubstrateDetails
DB00962Zaleplonapproved, illicit, investigationalunknownsubstrateDetails
DB00246ZiprasidoneapprovedunknownsubstrateDetails
DB00425ZolpidemapprovedunknownsubstrateDetails
DB01167Itraconazoleapproved, investigationalunknowninhibitorDetails
DB01149Nefazodoneapproved, withdrawnunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB01118Amiodaroneapproved, investigationalunknowninhibitorDetails
DB00446Chloramphenicolapproved, vet_approvedunknowninhibitorDetails
DB00537Ciprofloxacinapproved, investigationalunknowninhibitorDetails
DB00705DelavirdineapprovedunknowninhibitorDetails
DB00176Fluvoxamineapproved, investigationalunknowninhibitorDetails
DB06730GestodeneinvestigationalunknowninhibitorDetails
DB01388Mibefradilinvestigational, withdrawnunknowninhibitorDetails
DB01059NorfloxacinapprovedunknowninhibitorDetails
DB06731SeproxetineinvestigationalunknowninhibitorDetails
DB00582Voriconazoleapproved, investigationalunknowninhibitorDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB06772CabazitaxelapprovedunknownsubstrateDetails
DB06697ArtemetherapprovedunknownsubstrateDetails
DB00701Amprenavirapproved, investigationalunknownsubstrateDetails
DB00278Argatrobanapproved, investigationalunknownsubstrateDetails
DB00394Beclomethasone dipropionateapproved, investigationalunknowninducerDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateinducerDetails
DB00608Chloroquineapproved, investigational, vet_approvednosubstrateDetails
DB00822DisulfiramapprovedunknownsubstrateDetails
DB00655EstroneapprovedunknownsubstrateDetails
DB00773EtoposideapprovedunknownsubstrateinducerDetails
DB00499Flutamideapproved, investigationalunknownsubstrateDetails
DB01218HalofantrineapprovedunknownsubstrateDetails
DB01103QuinacrineinvestigationalnosubstrateDetails
DB00745Modafinilapproved, investigationalnoinhibitorinducerDetails
DB00622Nicardipineapproved, investigationalunknowninhibitorDetails
DB00393Nimodipineapproved, investigationalunknownsubstrateDetails
DB00717NorethisteroneapprovedunknownsubstrateDetails
DB00776OxcarbazepineapprovednoinducerDetails
DB01062Oxybutyninapproved, investigationalunknownsubstrateDetails
DB00497Oxycodoneapproved, illicit, investigationalunknownsubstrateDetails
DB00780PhenelzineapprovedunknowninhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB01058Praziquantelapproved, investigational, vet_approvedunknownsubstrateDetails
DB00863RanitidineapprovedunknowninhibitorDetails
DB00206Reserpineapproved, investigationalunknowninducerDetails
DB01098RosuvastatinapprovedunknowninhibitorDetails
DB00444TeniposideapprovednosubstrateDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninhibitorDetails
DB00862VardenafilapprovedunknownsubstrateDetails
DB00530Erlotinibapproved, investigationalunknownsubstrateDetails
DB00588Fluticasone propionateapprovedunknownsubstrateinhibitorDetails
DB00738Pentamidineapproved, investigationalunknownsubstrateDetails
DB00755Tretinoinapproved, investigational, nutraceuticalnosubstrateDetails
DB01254Dasatinibapproved, investigationalunknownsubstrateDetails
DB01259Lapatinibapproved, investigationalunknownsubstrateDetails
DB04946IloperidoneapprovedunknownsubstrateDetails
DB06176Romidepsinapproved, investigationalunknownsubstrateDetails
DB06335SaxagliptinapprovedunknownsubstrateDetails
DB06413Armodafinilapproved, investigationalunknowninducerDetails
DB00575ClonidineapprovedunknownsubstrateDetails
DB06419CethromycininvestigationalunknownsubstrateDetails
DB08873Boceprevirapproved, withdrawnunknownsubstrateinhibitorDetails
DB06228RivaroxabanapprovedunknownsubstrateDetails
DB08883PerampanelapprovednosubstrateDetails
DB08865CrizotinibapprovedunknownsubstrateinhibitorDetails
DB06605ApixabanapprovedunknownsubstrateDetails
DB06626Axitinibapproved, investigationalnosubstrateDetails
DB08899EnzalutamideapprovedunknownsubstrateDetails
DB08901Ponatinibapproved, investigationalunknownsubstrateDetails
DB05773Trastuzumab emtansineapproved, investigationalunknownsubstrateDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateDetails
DB01095FluvastatinapprovedunknownsubstrateDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateDetails
DB00317Gefitinibapproved, investigationalunknownDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB09053IbrutinibapprovedunknownsubstrateDetails
DB09068Vortioxetineapproved, investigationalnoDetails
DB09102Daclatasvirapproved, investigationalunknownsubstrateDetails
DB06403Ambrisentanapproved, investigationalnosubstrateDetails
DB06789Hydroxyprogesterone caproateapproved, investigationalunknownsubstrateDetails
DB09297Paritaprevirapproved, investigationalnosubstrateDetails
DB12161Deutetrabenazineapproved, investigationalyessubstrateDetails
DB11915Valbenazineapproved, investigationalnosubstrateDetails
DB08820IvacaftorapprovednosubstrateDetails
DB09054IdelalisibapprovednosubstrateinhibitorDetails
DB09065CobicistatapprovedyessubstrateinhibitorDetails
DB06412Oxymetholoneapproved, illicitunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB06595Midostaurinapproved, investigationalunknowninducerDetails
DB11574ElbasvirapprovedunknownsubstrateinhibitorDetails
DB12483Copanlisibapproved, investigationalnosubstrateDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownsubstrateDetails
DB09231BenidipineexperimentalnosubstrateDetails
DB11633Isavuconazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB11712Tezacaftorapproved, investigationalnosubstrateDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB00820Tadalafilapproved, investigationalunknownsubstrateDetails
DB05521Telaprevirapproved, withdrawnunknownsubstrateDetails
DB00625Efavirenzapproved, investigationalunknowninducerDetails
DB00199Erythromycinapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB14185Aripiprazole lauroxilapproved, investigationalunknownsubstrateDetails
DB12070Letermovirapproved, investigationalunknowninhibitorDetails
DB14538Hydrocortisone aceponateexperimental, vet_approvedunknownsubstrateDetails
DB14539Hydrocortisone acetateapproved, vet_approvedunknownsubstrateDetails
DB14540Hydrocortisone butyrateapproved, vet_approvedunknownsubstrateDetails
DB14541Hydrocortisone cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB14542Hydrocortisone phosphateapproved, vet_approvedunknownsubstrateDetails
DB14543Hydrocortisone probutateapproved, vet_approvedunknownsubstrateDetails
DB14544Hydrocortisone valerateapproved, vet_approvedunknownsubstrateDetails
DB14545Hydrocortisone succinateapprovednosubstrateDetails
DB01222BudesonideapprovednoinducerDetails
DB06654Safinamideapproved, investigationalunknowninhibitorDetails
DB11703Acalabrutinibapproved, investigationalunknowninhibitorDetails
DB01267PaliperidoneapprovedunknownsubstrateDetails
DB11737Icotinibexperimental, investigationalunknownsubstrateinducerDetails
DB00909Zonisamideapproved, investigationalnosubstrateDetails
DB09256Tegafurapproved, investigationalunknownsubstrateDetails
DB12301Doravirineapproved, investigationalunknownDetails
DB12130Lorlatinibapproved, investigationalunknownsubstrateDetails
DB09074OlaparibapprovedunknownsubstrateDetails
DB08930DolutegravirapprovedunknownsubstrateDetails
DB06595Midostaurinapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB13174RheinexperimentalunknowninhibitorDetails
DB11994Diacereinapproved, investigationalunknowninhibitorDetails
DB11605MyrrhapprovedunknowninducerDetails
DB11691Naldemedineapproved, investigationalnosubstrateDetails
DB13878Pibrentasvirapproved, investigationalunknowninhibitorDetails
DB13879Glecaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateDetails
DB09568Omega-3-carboxylic acidsapproved, investigationalnosubstrateDetails
DB01601LopinavirapprovednoinhibitorDetails
DB01149Nefazodoneapproved, withdrawnnoinhibitorDetails
DB11431Moxidectininvestigational, vet_approvednosubstrateDetails
DB13141Ambroxol acefyllinateexperimental, investigationalnosubstrateDetails
DB11792MirodenafilinvestigationalunknownsubstrateDetails
DB11979Elagolixapproved, investigationalyessubstrateDetails
DB08865CrizotinibapprovedunknowninhibitorDetails
DB11703Acalabrutinibapproved, investigationalunknownsubstrateDetails
DB12267Brigatinibapproved, investigationalunknowninducerDetails
DB12307ForetinibinvestigationalunknownsubstrateDetails
DB09205Moxisylyteapproved, investigationalnosubstrateDetails
DB12130Lorlatinibapproved, investigationalunknownsubstrateinhibitorinducerDetails